KEGG   Blattabacterium sp. (Mastotermes darwiniensis): MADAR_042Help
Entry
MADAR_042         CDS       T01642                                 

Gene name
sucB
Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bmm  Blattabacterium sp. (Mastotermes darwiniensis)
Pathway
bmm00020  Citrate cycle (TCA cycle)
bmm00310  Lysine degradation
bmm01100  Metabolic pathways
bmm01110  Biosynthesis of secondary metabolites
bmm01120  Microbial metabolism in diverse environments
bmm01130  Biosynthesis of antibiotics
bmm01200  Carbon metabolism
Module
bmm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bmm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bmm00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MADAR_042 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    MADAR_042 (sucB)
Enzymes [BR:bmm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     MADAR_042 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N PYNP_C
Motif
Other DBs
NCBI-ProteinID: AER40367
UniProt: G7SQU8
Position
50003..51169
Genome map
AA seq 388 aa AA seqDB search
MTIKVKVPSPGESITEVEVSSWFVKNGDYVSKNQLIAEIDSDKVTLEIHAEENGVITLMA
KKGERIKVGDILCIIDKESSDENSKKSLETNVKKKEKILYKKFPSPASKKILKEKNISIE
SIQGTGKHGRITKKDCITKERFNSRSTRVTPLSSLRRKLSERLVSVKNQTAMLTTFNEVD
MQEIIFIRKKYKNIFQEKHGVNLGFMSFFTLSCVRSLNLYPDVNAMIINEKEKINFEYCD
ISIAISGPKGLMVPVIRNAENLSFLGIEKEISRLSTSVRNGTISINEMKGGTFTITNGGV
FGSMLSTPIINPPQSAILGMHKIVERPVVINGGIKIRPIMYLALSYDHRIIDGKESVGFL
VSVKESIENPIDFLMEGSEKNIPRILEL
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgacaataaaagtaaaggtcccttctccaggagaatcgattacagaagtagaggtatct
tcatggttcgtaaaaaatggagattatgtttccaaaaatcaactaatagctgaaatagat
tcagataaagttactttagaaattcatgcagaagaaaatggcgtaataaccttaatggca
aaaaaaggtgaaagaataaaagttggggatattctatgtatcatagataaagaatcttct
gatgaaaattctaaaaaatcattggagactaatgttaaaaaaaaggaaaaaatactttat
aaaaaatttccttctccagcttcaaaaaaaatattaaaagaaaagaacatttctatagaa
tcgattcaaggaactggaaaacatggacgaattacaaaaaaagattgtattactaaggaa
agattcaactctcgttccacaagagtaactcctctttcttctctaagaagaaaattatcg
gaaaggttggtttctgtaaagaatcaaacagctatgctaactacttttaatgaagtagat
atgcaagaaattattttcataaggaaaaaatataagaatatttttcaggaaaaacatgga
gttaatttaggtttcatgtctttttttaccctttcttgtgttaggagtttaaatctatat
ccagatgttaatgctatgattattaatgaaaaagaaaaaattaattttgaatactgtgac
attagcattgctatttctggacctaaagggttaatggttcccgtaattagaaatgcagaa
aatttatcttttcttgggatagaaaaagaaattagtagattatctacatctgttagaaac
ggaacaatatctatcaacgaaatgaaaggtggaacttttaccattactaatggaggagta
tttggttctatgctttctactccaataatcaatccaccacaaagcgctattttaggaatg
cataaaatagtagaaagacctgtagttattaatggaggtataaaaatacgtcctataatg
tatctagcgttgtcctatgatcatagaatcattgatggaaaagaatctgttggtttttta
gtttctgtgaaagaatcaatagaaaatccaatagattttctaatggaaggaagtgaaaaa
aacattcctagaatattagagttataa

DBGET integrated database retrieval system