KEGG   Blattabacterium MADAR (Mastotermes darwiniensis): MADAR_045Help
Entry
MADAR_045         CDS       T01642                                 

Gene name
sucC
Definition
succinyl-CoA synthetase, beta subunit
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bmm  Blattabacterium MADAR (Mastotermes darwiniensis)
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bmm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MADAR_045 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MADAR_045 (sucC)
   00640 Propanoate metabolism
    MADAR_045 (sucC)
   00660 C5-Branched dibasic acid metabolism
    MADAR_045 (sucC)
Enzymes [BR:bmm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     MADAR_045 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
52533..53720
Genome map
AA seq 395 aa AA seqDB search
MNLHEFQGREILNSFSVKVPDGIVANTPEKAVKAAKVILERTNKKSLVIKAQIHAGGRGK
GGGIQVVKSMEEVYEKSKNILGKPLITPQTSKRGKLVRKVLISENVYSCSHPTKEYYLSI
LLDRDLEKNVIIYSKEGGMDIEEISKKHPDKIYLEKIDPVWGIQLFQARKIGFDLGIKKY
FSDFLISLYNAYLSCDALLLEINPLIHTFDNKIIAVDIKMILDDNALFRHKEYANMRDKK
EEDPIEIEAIESKLNFIKLEGNVGCMVNGAGLAMATMDMIQSCGGKPSNFLDIGGDADKK
RVEKAFRLILKDPSVQAVLINIFGGIVRCDTVAEGIINSYHHNHDKKIPVIIRLQGTNEI
IGKKILENSQLPIFYTSTLKEASDKIKEILNCNNG
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacatgaattccaaggtagggaaatattaaattctttttccgttaaagttcct
gatggtatcgttgctaatactccagaaaaagctgtaaaagctgcaaaagtaatcttagaa
cgaaccaataaaaaatctttagttattaaagcacaaatacatgcaggtggtcgtggaaaa
ggtggaggtatacaagttgtaaaatctatggaagaagtatatgaaaaatctaaaaatatt
ttaggaaaacctttaattactccacaaacttcaaaaagaggaaaattagttcgtaaagtt
ctaatttctgaaaatgtatattcttgttctcatcctactaaagaatattatctatcgata
ttgctagatcgtgatctagaaaaaaatgttatcatatattctaaagaaggaggaatggat
attgaagaaatatctaaaaaacatccagataaaatctatttagaaaaaatagatcctgta
tgggggatccaactatttcaagctaggaaaataggatttgatttagggattaaaaaatat
ttcagcgattttttaatttctctttacaatgcttatttatcttgtgacgctttattatta
gagataaatcctttaattcatacattcgataataaaattatagccgtagacattaaaatg
atattggatgataatgctttatttcgtcataaggaatacgccaatatgcgtgataaaaaa
gaagaagatcctattgaaatagaagctatcgaatccaaattgaattttataaaattggaa
ggaaatgtaggatgtatggtgaatggagcaggattagctatggctactatggatatgatt
caatcttgtggaggaaaaccttctaattttttggatataggaggagatgctgataagaaa
cgtgtagaaaaagcatttcgtcttatattgaaagatccatcagttcaagccgtattgata
aatatttttggaggaattgttcgttgtgatacagtggcagaaggaattattaattcctat
caccataaccatgataaaaaaataccggttattattcgtttacaaggaactaatgaaata
ataggaaagaaaatacttgaaaatagtcaattaccaattttttatacttccactttaaaa
gaagcatctgataaaattaaagaaatattaaattgtaataatggataa

DBGET integrated database retrieval system