KEGG   Blattabacterium sp. (Mastotermes darwiniensis): MADAR_121Help
Entry
MADAR_121         CDS       T01642                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
bmm  Blattabacterium sp. (Mastotermes darwiniensis)
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:bmm00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:bmm00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(130274..131752)
Genome map
AA seq 492 aa AA seqDB search
MKKLLEDILREVDVLKMIGFSSNKWIEGLSICSKMIKKKNMIFFAHKGTRTDGHRFIIEA
IQNGANTIVCEKKPFLIQKSITYVLVQDSIIALGTISSNFYDNPTRKIKLVGITGTNGKT
SVATMLHSLFYKMGEKTILISTIGIKILSKKFTTEHTTPNIIDINKYLNISMKQGCKYGF
MEVSSHGIHQKRIEGLLFAGGVFTNITHDHLDYHQSFENYLSVKRFFFENYLQKNSFALI
NADDKNSHEIIKNVFAKTYFYGLKKKADFRIKILINNINGNRLIINGHSFFTGFIGEFNV
YNLLASYATSILLGKNKHEILKTINTIKPIKGRCEQFFSNSGIRIIVDYAHNPDGIKTVL
NTIKGIKKKEEKLICVIGCGGNRDKEKRSLMGKIVYETCDRSIFTSDNPREEDPEKILID
MKKFISNKKNKKDILTIVNRKLAIQTAIRIAKRKDIIVIAGKGHENYQEIQGKRYPFDDM
KIAKKFLKNLRK
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactattagaagatattctaagagaagtagatgtattaaaaatgataggattt
tcttctaataaatggatagaagggctttcgatatgctccaaaatgataaagaaaaaaaat
atgatttttttcgctcataaaggaacaaggacagacggacatagatttattatagaggct
atccaaaatggagctaacacaatagtttgcgaaaaaaaaccttttttaatccaaaaatct
atcacttatgtacttgtgcaagattcaataatcgctttaggaactatttcttctaatttt
tatgataatcctacaaggaaaataaaattggtaggaattactggaacaaatggaaaaacc
tctgtggctaccatgcttcattctttattttataagatgggagaaaaaaccattcttatt
tctaccattggaattaaaatcttatctaaaaaatttactactgaacatactactccaaat
atcattgatattaataaatatttaaatatttcgatgaaacaaggatgtaaatatggattt
atggaagtgagttcacatggaattcatcaaaaaagaattgaaggattgttatttgcagga
ggagtatttaccaatattacacatgaccatttagattatcatcaatcctttgaaaattat
ctatcagttaaaaggtttttttttgaaaattatttgcagaaaaattcctttgcattaatc
aatgcagacgataaaaattcacatgaaataataaaaaatgtttttgctaaaacctatttt
tatggattgaaaaagaaagcagattttaggattaaaattttgataaataatatcaatgga
aatcgattgataattaatggtcattcattttttacaggttttattggagaatttaatgtt
tacaatctattggccagttacgctacatctatattattgggcaaaaacaaacatgaaata
ttgaaaacaataaatactatcaaacctataaaaggacgttgtgaacaatttttttcaaat
tccggaattcgtattattgtggattacgcccataatccagatggaataaagacagtttta
aatactattaaaggaatcaaaaaaaaagaggaaaaattaatttgcgtaataggttgtgga
ggaaatagagacaaagaaaaacgttccttaatgggaaaaattgtttatgaaacatgtgat
agatctatttttacatcggataatcctagggaagaagatccagaaaaaatattaatagat
atgaaaaagtttatatccaataagaaaaataaaaaggatattttaacgattgttaatcga
aaattagccattcaaaccgctattcgaattgcaaaaagaaaagatataattgttatagca
ggaaaaggacacgaaaattatcaagaaattcaagggaaacgttatccttttgacgatatg
aaaattgctaaaaagttcttaaaaaatttaagaaaatga

DBGET integrated database retrieval system