KEGG   Blattabacterium sp. (Mastotermes darwiniensis): MADAR_183Help
Entry
MADAR_183         CDS       T01642                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bmm  Blattabacterium MADAR (Mastotermes darwiniensis)
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmm00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    MADAR_183 (glpK)
Enzymes [BR:bmm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     MADAR_183 (glpK)
Exosome [BR:bmm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MADAR_183 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
190563..192053
Genome map
AA seq 496 aa AA seqDB search
MKKYVLSLDQGTTSSRAIIFDKIGNIISVAQREFTQIYPYPGWVEHNAEEIWSTQASVAL
EAILKANLEGENIVSIGITNQRETTVVWDKRTGEPIFNAIVWQDRRTSNYCDQIKYDGLT
EMIRKKTGLVIDPYFSATKIKWILENVPGARDKANSGNLAFGTIDSWLIWNLTGKEIHVT
DVTNASRTMLFNIHTLSWDQDLINLFDIPYTMLPSVKSSSEIFGYTTGHILSHKIPISGI
AGDQQAALFGQMCTKIGMVKNTYGTGCFMLMNVGETPVFSQNNLITTIAWKIKDKIQYAL
EGSVFIAGAVVQWLRDGLGLLLSSSEAELLASSVENTEGLYMVPAFSGLGAPYWDQKARG
TIVGITRGTSSAHFVRAALESIAFQNMDVLKAMEADSGISIKELRVDGGATVNKLLMQFQ
SEILNVKVVKSKISELTAAGAAYLAGLAVNYWTGLEEIQENWKLEHIFEPKGMSSRLERI
KGWKRAIKTTRSWSSK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatatgtgctttcattagatcagggaactactagttctagagctattattttt
gataaaattggaaatattatttccgtagctcaaagagagtttacacaaatttatccttac
cctggatgggtagaacataatgcagaagaaatatggtctacgcaagcttctgttgcttta
gaagctattttaaaagcaaatttagaaggggaaaatattgtttcaataggaataactaac
caaagagaaactactgttgtatgggataaaagaacgggcgaacctatttttaatgctatc
gtttggcaagatagacgtacatccaactattgtgatcaaataaaatatgatggattaact
gaaatgattagaaaaaaaacaggtctcgttatagatccttatttttctgctacgaaaata
aaatggatattagaaaatgttccaggagcaagagataaagctaattctggaaatttagct
tttggaactatagattcatggttaatatggaatttaaccggaaaagaaattcatgtaaca
gatgtaaccaatgcttctagaactatgctgttcaatattcatactcttagttgggatcaa
gatttaatcaatttattcgatattccatatacaatgcttccatcagtaaaatcatctagt
gaaattttcggttatacaactggtcatatactttctcataaaattcctatttctggaatt
gctggagatcaacaagctgcactttttggtcaaatgtgcacgaagattggaatggtgaaa
aatacttatggaacgggttgttttatgttgatgaatgtaggagagactcctgttttttct
caaaataatttaataactactattgcttggaaaattaaagataaaattcaatatgcttta
gaaggtagtgtttttatagcaggggcagttgtacaatggcttagggatggattaggttta
ctgttatcttcaagtgaagcagaactacttgcttcttcagtagaaaatacagaagggttg
tatatggtaccagctttttccggattaggagctccttattgggatcaaaaagcaagagga
accattgtaggaataacaagagggacttcttctgctcattttgtacgtgcagctttggaa
agtattgcttttcaaaatatggatgtattgaaagccatggaggctgattcaggaatttct
atcaaagaacttcgtgtagatggaggggcaacagtcaataaattattgatgcaatttcaa
tctgagatcctcaatgtgaaagtagttaaatccaaaatttctgaacttacagcagcagga
gcagcttatctagcaggattagccgtaaattattggactggtcttgaagaaattcaggag
aactggaaattagaacatatttttgaaccaaaaggaatgtcaagtcgtttggaaagaatt
aaaggttggaaaagagcaataaaaactaccagatcttggtctagtaaataa

DBGET integrated database retrieval system