KEGG   Blattabacterium sp. (Mastotermes darwiniensis): MADAR_319Help
Entry
MADAR_319         CDS       T01642                                 

Gene name
gmk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
bmm  Blattabacterium MADAR (Mastotermes darwiniensis)
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:bmm00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    MADAR_319 (gmk)
Enzymes [BR:bmm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     MADAR_319 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
331658..332209
Genome map
AA seq 183 aa AA seqDB search
MIILSGPSGSGKTTISQYLLSKIPELKFSVSCTTRSMRNNEKHGKDYYFLSTKRFISKIK
KYQFVEWEEVYPQLFYGTLKNEISKIWNENKHILFDVDVKGGLSLQRKYPYNSLSIFVMV
KSMKILKERLFTRNSNNMNIRLNKAKIEWKYANLFDVILLNVDLLKTKKKAVQLVSNFIN
KSG
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgattattctatcaggtccttcaggatctggaaaaacaactatttcacaatacttactt
tcaaaaatcccagaattaaaattttccgtatcgtgtaccacacgttccatgagaaataat
gaaaaacatggaaaagattattattttctttctacaaagagatttatttccaagataaaa
aaatatcaatttgtagaatgggaagaagtttatcctcaattattttatggaacgttaaaa
aacgaaatttccaaaatttggaacgaaaacaaacatatcttatttgatgtagatgtaaaa
ggtggcttatctttacaaagaaaatatccatacaattctttatccatatttgtaatggta
aaatccatgaaaattttaaaagaaagactttttacaagaaattccaataatatgaatata
cgtttaaataaagccaaaatagaatggaaatatgcaaatttattcgatgtcattttgcta
aatgtagatttgttgaaaacaaaaaaaaaagccgttcaattagtttctaattttataaat
aaatcggggtga

DBGET integrated database retrieval system