KEGG   Blattabacterium sp. (Mastotermes darwiniensis): MADAR_508Help
Entry
MADAR_508         CDS       T01642                                 

Gene name
tpiA
Definition
triose-phosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bmm  Blattabacterium sp. (Mastotermes darwiniensis)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:bmm01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:bmm01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bmm00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:bmm00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(507018..507770)
Genome map
AA seq 250 aa AA seqDB search
MRKKVVIANWKMNQDFYETTSFLRNLLKIIFEINHKKEIIIAPSFPFLHISNQILQGSTL
SIAAQNIHQMENGSYTGEVSASMLKSIGVQKVILGHSERRKHFSETNDILIKKIKTALKY
KFIIIFCVGETEVERRKKEHFLSVKYQLEETIFHFSLENISSFIIAYEPIWAIGTGKTAT
PEVVQVMHQYIRSLFMDKYGKNISRKISILYGGSINDLNAKSLFYQKDIDGGLVGNSSLN
IEKFMRIIQS
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaaaagttgtaattgccaattggaaaatgaatcaggatttctatgaaactact
tcttttcttagaaacttattaaaaattatttttgaaatcaatcacaaaaaagaaataatt
attgcaccatcttttccttttttacatatttcaaatcaaattttacaggggagtacttta
agtattgctgcacaaaatatccatcaaatggaaaatggatcctatacaggagaagtatct
gcttctatgttaaaatctataggagttcaaaaagtaatattaggacatagcgaacgtagg
aaacatttttcagaaacaaatgatattttaattaaaaaaattaaaactgcattaaaatat
aaatttattattattttttgtgttggagaaacagaagttgaaagaagaaaaaaagaacat
tttttgtccgtaaagtatcaattggaagaaactatttttcatttttctttagaaaatata
agttctttcattatagcatatgaaccaatatgggctattggaacaggaaaaacagctaca
cctgaagtagttcaggttatgcatcaatatattcgttctttgtttatggataaatatgga
aaaaatatttccagaaagatatctattttgtatggaggaagcatcaatgatcttaatgct
aagtctcttttttatcagaaagatatagatggaggtcttgttggaaattcttcactaaat
atagaaaaatttatgagaattattcaatcttaa

DBGET integrated database retrieval system