KEGG   Blattabacterium MADAR (Mastotermes darwiniensis): MADAR_514Help
Entry
MADAR_514         CDS       T01642                                 

Gene name
aceF
Definition
dihydrolipoamide acyltransferase E2 component
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bmm  Blattabacterium MADAR (Mastotermes darwiniensis)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bmm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MADAR_514 (aceF)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MADAR_514 (aceF)
   00020 Citrate cycle (TCA cycle)
    MADAR_514 (aceF)
   00620 Pyruvate metabolism
    MADAR_514 (aceF)
Enzymes [BR:bmm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MADAR_514 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
512376..513503
Genome map
AA seq 375 aa AA seqDB search
MAEIIYMPKLSDTMEEGTVIKWNKKIGDKVSEGDILAEIETDKAIQDFEIDVSGVLLFIG
VKEGEKTRVNEILAILGEEGEDISSLIKKSFSLKKEEKIVLEKKENRVFISPLAKKMAKE
IGMSTDKIKGSGDNSRIIKRDIEKTSENNDQIIILSSIRKKIAENLTHSKFTAPHYYLFI
EVNTEKMIHLRKNLNDKLPTEEKISFNDLLVKAVAKSLRKHPNVNTSWKEKEIIYHSNIN
VGVAVAIKEGLIVPVIKNTDQKSLLQISQEIKDKSLRSRLRKIKPEEMENSTFTVSNLGM
YGIEFFTSIINLPNSSILSIGTIMEKPVVKDSKIEIGHVMKLTLSCDHRIIDGSTGSNFL
QFLKNMLEDPMGILV
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaataatatacatgccaaaattgagcgacactatggaagagggaactgtaata
aaatggaataaaaaaataggagataaagtttccgaaggagatattttagcagaaattgaa
acggataaagctattcaagattttgaaatagatgtaagtggcgttttactttttattggg
gttaaagaaggagaaaaaacacgtgttaatgaaatattagccattcttggtgaagaaggg
gaggatataagttccctcataaaaaaaagtttttcattaaaaaaagaagaaaaaattgtt
cttgaaaaaaaagaaaatagagtttttatctcccctttagcaaaaaaaatggcaaaagaa
ataggaatgtctactgataagattaagggaagtggagataacagtcgtattattaaaaga
gatattgaaaaaacatcagaaaataatgatcaaataattatactttcttctatcagaaaa
aaaatagcagaaaatttaacacattccaaatttacagctccacactattatcttttcata
gaagtaaatacagaaaaaatgattcatttaaggaaaaacttaaacgataaacttcctaca
gaagaaaaaatatcttttaatgacctccttgttaaagctgtagctaaatctctaagaaaa
catcctaatgtgaatacatcgtggaaagaaaaagaaataatatatcattccaatattaat
gttggagtagcagtagctataaaagaagggctaattgttccggtgattaaaaataccgat
caaaaatcattattacaaatatctcaagaaataaaagataaatcattacgttcaaggtta
aggaaaataaaaccagaagaaatggaaaatagcacgtttacagtttccaatttaggaatg
tatggaatagaattctttacctctattattaatcttcctaattcttctattctatctata
ggaactattatggaaaaaccagtggttaaagattcaaagattgaaataggacatgttatg
aaattgacattatcctgtgatcatagaattatagatggatctacaggaagtaattttctt
caatttttgaaaaatatgttagaagacccaatgggaatattagtttga

DBGET integrated database retrieval system