KEGG   Blattabacterium sp. (Mastotermes darwiniensis): MADAR_546Help
Entry
MADAR_546         CDS       T01642                                 

Gene name
speB
Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bmm  Blattabacterium sp. (Mastotermes darwiniensis)
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bmm00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
548053..548904
Genome map
AA seq 283 aa AA seqDB search
MKKKTFAGIPKKYATLEKSQIVLIPVPYDSTETWKKGSNRGPEAFLSASEHMELYDIETD
SEVYKKGIFLAAPIGNTSLSSNKMIEKVYHTTKKYLLKEKFVTLIGGEHSISIGSIRAFG
EKYTDMSILHMDAHTDLRPKYNGNPYNHACSMFEASKKYPLIQIGIRSMDVLEKKYIQNE
NIFYFHKIYQNDSWMKEAIQRLSQNVFISIDIDVFDPSIAPSTGTPEPGGFFWYEILKFF
RMVFENKKIIGFDIVELLPNKKDYSTDFLSVKLYYKLLSYKYY
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaaaacttttgctggtattcctaaaaaatatgctactcttgaaaaatcacaa
atagtactaataccagttccgtatgattctactgaaacatggaaaaaaggatctaataga
ggacctgaagcttttttatctgcatcggaacatatggaattgtatgatatagaaacagat
tcagaagtatacaaaaaaggaatttttcttgctgctcctattggaaatacttcattatcg
tctaataaaatgatagaaaaagtatatcacactaccaagaagtatcttttaaaagaaaaa
tttgtaactctcataggaggagaacattctatatccataggaagtattcgagcatttgga
gaaaaatatacagatatgagcatccttcacatggatgcacatacagatttacgtcctaaa
tacaatggaaatccttacaatcatgcttgttctatgtttgaagcctcaaaaaaatatcca
ctgatacagataggaattcgtagtatggatgtactagaaaaaaagtatattcaaaatgaa
aatattttttattttcataaaatctatcaaaatgattcatggatgaaggaagctattcaa
agattatcacaaaatgtatttataagtatagatatagatgtatttgatccaagtatagct
ccttctacaggaactccagaaccaggaggttttttttggtacgaaatattaaaatttttt
cgaatggttttcgaaaataaaaaaattataggatttgatattgttgaacttttaccaaat
aaaaaagattactccacagattttttatccgttaaactttactataaattattatcatat
aaatactactaa

DBGET integrated database retrieval system