KEGG   Blattabacterium MADAR (Mastotermes darwiniensis): MADAR_546Help
Entry
MADAR_546         CDS       T01642                                 

Gene name
speB
Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bmm  Blattabacterium MADAR (Mastotermes darwiniensis)
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmm00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    MADAR_546 (speB)
Enzymes [BR:bmm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     MADAR_546 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
548053..548904
Genome map
AA seq 283 aa AA seqDB search
MKKKTFAGIPKKYATLEKSQIVLIPVPYDSTETWKKGSNRGPEAFLSASEHMELYDIETD
SEVYKKGIFLAAPIGNTSLSSNKMIEKVYHTTKKYLLKEKFVTLIGGEHSISIGSIRAFG
EKYTDMSILHMDAHTDLRPKYNGNPYNHACSMFEASKKYPLIQIGIRSMDVLEKKYIQNE
NIFYFHKIYQNDSWMKEAIQRLSQNVFISIDIDVFDPSIAPSTGTPEPGGFFWYEILKFF
RMVFENKKIIGFDIVELLPNKKDYSTDFLSVKLYYKLLSYKYY
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaaaacttttgctggtattcctaaaaaatatgctactcttgaaaaatcacaa
atagtactaataccagttccgtatgattctactgaaacatggaaaaaaggatctaataga
ggacctgaagcttttttatctgcatcggaacatatggaattgtatgatatagaaacagat
tcagaagtatacaaaaaaggaatttttcttgctgctcctattggaaatacttcattatcg
tctaataaaatgatagaaaaagtatatcacactaccaagaagtatcttttaaaagaaaaa
tttgtaactctcataggaggagaacattctatatccataggaagtattcgagcatttgga
gaaaaatatacagatatgagcatccttcacatggatgcacatacagatttacgtcctaaa
tacaatggaaatccttacaatcatgcttgttctatgtttgaagcctcaaaaaaatatcca
ctgatacagataggaattcgtagtatggatgtactagaaaaaaagtatattcaaaatgaa
aatattttttattttcataaaatctatcaaaatgattcatggatgaaggaagctattcaa
agattatcacaaaatgtatttataagtatagatatagatgtatttgatccaagtatagct
ccttctacaggaactccagaaccaggaggttttttttggtacgaaatattaaaatttttt
cgaatggttttcgaaaataaaaaaattataggatttgatattgttgaacttttaccaaat
aaaaaagattactccacagattttttatccgttaaactttactataaattattatcatat
aaatactactaa

DBGET integrated database retrieval system