KEGG   Burkholderia mallei NCTC 10247: BMA10247_0410Help
Entry
BMA10247_0410     CDS       T00479                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bmn  Burkholderia mallei NCTC 10247
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bmn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BMA10247_0410 (tpiA)
   01230 Biosynthesis of amino acids
    BMA10247_0410 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMA10247_0410 (tpiA)
   00051 Fructose and mannose metabolism
    BMA10247_0410 (tpiA)
   00562 Inositol phosphate metabolism
    BMA10247_0410 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BMA10247_0410 (tpiA)
Enzymes [BR:bmn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BMA10247_0410 (tpiA)
Exosome [BR:bmn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BMA10247_0410 (tpiA)
  Exosomal proteins of bladder cancer cells
   BMA10247_0410 (tpiA)
  Exosomal proteins of melanoma cells
   BMA10247_0410 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:400459..401259
Genome map
AA seq 266 aa AA seqDB search
MNTTPGFGASTTRQTMSKQRIKRVIGNWKMHGRLSGNEALLDEVAQGAQAVPEHVGIGVC
VPFPYLAQARARLHGGRVAWGAQDVSAHEQGAFTGEVAAGMVAEFGAAYAIVGHSERRAY
HGESNEIVAAKAQRALAAGLTPVVCVGETLAEREAGATEQVVGVQLDAVLAVLSQDEAAR
IVVAYEPVWAIGTGRSATAEQAQQVHAFLRGRLAAKGAERVSLLYGGSVKADNAAELFGQ
PDIDGGLIGGASLKSGDFLAICRAAQ
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaacacgacgcccggcttcggcgcgtccacgacgagacaaacgatgtcgaaacaaaga
atcaagcgggtgatcggcaactggaagatgcacggtcgcctgagcggcaacgaggcgctg
ctcgacgaagtcgcgcagggcgcgcaagccgtgcccgagcacgtcggcatcggcgtgtgc
gtgccgtttccgtatctcgcgcaggcgcgggcccggcttcacggcggtcgcgtcgcgtgg
ggcgcgcaggacgtatctgcgcacgagcagggcgcctttaccggcgaagtcgcggccggc
atggtcgcggagttcggcgcggcgtacgcgatcgtcgggcactcggagcgccgcgcgtat
cacggcgaatcgaacgagatcgtcgcggcgaaggcgcaacgtgcgctcgccgcggggctg
acgcccgtcgtgtgcgtcggcgagacgctcgccgagcgcgaagcgggggcgaccgagcag
gtcgtcggcgtgcagctcgacgcggtgctcgcggtgctgtcgcaggacgaggcggcgcgc
atcgtcgtcgcgtacgagcccgtatgggcgatcggcacgggccgcagcgcgacggcggag
caggcgcagcaggtgcacgcgttcctgcgcgggcggctcgcggcgaagggcgccgagcgc
gtgtcgctgctgtatggcggcagcgtgaaggccgacaacgcggccgagctgttcggccag
cctgacatcgacggcggcctgatcggcggcgcgtcgttgaagagcggggatttcctggcg
atttgccgggcggcgcagtaa

DBGET integrated database retrieval system