KEGG   Burkholderia mallei NCTC 10247: BMA10247_0473Help
Entry
BMA10247_0473     CDS       T00479                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bmn  Burkholderia mallei NCTC 10247
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bmn00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BMA10247_0473 (recD)
Enzymes [BR:bmn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BMA10247_0473 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:463994..466684
Genome map
AA seq 896 aa AA seqDB search
MVDERFAWTGGLADRLPEPADFGLALAEGFARRIGMLSRRVGASAAAARWAARAAFAASR
ATAAGHVCVALRALAQRDDEPYDDVRAALAASGVTAFDGIVRGGECPLVVDRDGRLYLAR
YFEYETRLANALVERSRCGGAPAGGADALSPDALGERLVRYFGPQKERGVDWQRVAALIA
LTGRVTIVSGGPGTGKTTTVVGVIACLLDAHPDLRIALAAPTGKAAQRMQEALHARAGSL
PAELAARLPRTSCTLHRLLGGGPGGRFAHHRDNPLPYDLVVVDEASMIDVALAAHLLDAL
APNARLVLLGDKDQLAAVEAGAVFAELSARPAFSPATCATIARTLGVGEAEFVAALPDGF
VVQAGGAERVADARAAAADMDAAARGTAGAAAAAARTTAAAAARMTTAAAAATGAAPESA
AQRAPAPHAGRRGGGRASNRTVDDAQGSLFAFDDDAFGGGTSGGEPGAGAQGAGRRDGGA
PSLDGPHAGHRDGGASPGVAHSRRDAFDARARSGSADVSDLENAARAYAPAGAAGPADSP
ADASFVEPAAWIEADELAWLDNAVFSFSEGASANAEADGRRSAAATATDAGARTAPPVAR
EATAPTPRETARSDGSAVAPLTDCVVWLERNYRFGLDSPIGRLSLAIRRGAVQDALDALS
TQDDAAARFSDDGGATLSAATVEQLARGFAGYAAALRDALATPEPDALPLFDVLNRFRVL
CATRTGARGAEEVNARMAAEVRRAVRVPLALGAHWFAGRPVMVTRNDYALGLFNGDIGIA
LPGARGALRVWFRGADGRARAVSPAALPPHDTAFALTVHKSQGSEFDDAALILPASFNRV
LSRELVYTAITRARARVQVIGSRAVLALAIATRTARDSGLAARIADALRARQEGAR
NT seq 2691 nt NT seq  +upstreamnt  +downstreamnt
gtggtcgacgaacgtttcgcgtggacgggcggcctggcggaccgtctgcccgagccggcc
gatttcgggctcgcgctcgccgaaggcttcgcgcgccggatcgggatgctgtcgcggcgt
gtcggcgcgagcgccgcggccgcgcgctgggcggcacgcgcggcgttcgccgcgagccgc
gcgacggcggcggggcacgtatgcgtcgcgctgcgcgcgctcgcgcagcgcgacgacgag
ccgtacgacgacgtacgcgcggcgctcgccgcgagcggcgtgaccgcgttcgacggcatc
gtgcgcggcggcgagtgcccactcgtcgtcgatcgcgatggtcggctgtatctcgcgcgc
tacttcgaatacgagacgcggctcgcgaacgcgctcgtcgagcggagccgatgcggcggc
gcgccggcgggcggcgccgatgcgctctcgcccgacgcgctcggcgagcggctcgtccgc
tatttcgggccgcagaaggagcggggcgtcgattggcagcgcgttgcggccctcatcgcg
ctcacgggccgcgtgacgatcgtgagcggcgggccgggcaccggcaagacgacgacggtc
gtcggcgtgatcgcgtgcctgctcgatgcgcatccggacttgcggatcgcgcttgccgcg
cccaccggcaaggccgcgcagcggatgcaggaggcgctgcacgcgcgcgccggcagcctg
ccggcggaactcgcggcgcgcctgccgcgcacgtcctgcacgctgcaccggctgctgggc
ggtggcccgggcgggcgcttcgcgcaccaccgcgacaatccgctgccgtacgatctcgtc
gtcgtcgacgaggcttcgatgatcgacgtcgcgctcgccgcgcatttgctcgacgcgctc
gcgccgaacgcgcgcctcgtgctgctcggcgacaaggatcagctcgcggccgtcgaggcg
ggcgcggtgttcgccgagctgagcgcgcgtcccgcgttcagcccggcgacgtgcgcgacg
atcgcgcgcacgctcggcgtcggcgaggccgagttcgtggcggcgctgccggacgggttc
gtcgtgcaggcgggcggcgcggagcgcgtggcggacgcgcgtgcggcagcggccgatatg
gacgcggccgcgcgcgggacggccggcgccgcagctgcggccgcacgaacgaccgcggcc
gcagccgcacgaatgaccacggccgcagccgcggcgacgggggccgcgccggaatccgcc
gcgcaacgcgcgccggcgccgcacgcgggccggcgcggcggcgggcgcgcatcgaatcgg
accgtcgacgatgcgcagggatcgttgttcgcgttcgacgacgacgcattcggtgggggc
acgtcgggcggcgagccgggggccggcgcgcaaggtgccgggaggcgagatggcggggcg
ccgagcctcgacgggccgcacgccgggcatcgggacggcggcgcatcgcccggcgtcgcg
cacagccggcgcgatgcgttcgacgcgcgtgcccggtcgggttcggcggatgtttccgac
ctggaaaacgccgcgcgcgcgtacgcgccggcgggcgcagccggcccggccgattcgccg
gcggacgcgtctttcgtcgagccggccgcgtggatcgaagcggacgaactcgcgtggctc
gacaacgcggtcttttcgttctccgaaggcgcttcggcgaatgccgaagccgacgggcgg
cgaagcgccgcggcgacggcgaccgacgcgggcgcgcgcaccgcgccgccggttgcgcgg
gaagcgacggcgccgacgccgcgcgagaccgcgcgatcggacggttccgccgtcgcgccg
ctgaccgactgcgtcgtctggcttgaacgcaactatcgcttcggccttgattcgccgatc
ggccggctgtcgcttgcgattcgccgcggcgcggtgcaggacgcgctcgacgcgctatcg
acgcaagacgacgcggccgcgcgttttagcgacgacggcggtgcgacgctgtcggccgcg
acggtcgagcagctcgcgcgaggcttcgccggctatgcggccgcgctgcgcgacgcgctg
gcgacgcccgaacccgatgcgctgccgctcttcgacgtgctcaaccgctttcgcgtgctt
tgcgcgacgcgcacgggcgcgcgcggcgcggaggaagtcaacgcgcgcatggcggccgag
gtgcgccgcgcggtgcgcgtgccgctcgcgctcggtgcgcactggttcgccggacggccc
gtgatggtgacgcgcaacgattacgcgctcggcctcttcaacggcgacatcggcattgcg
ctgcccggcgcgcgcggtgcgctgcgcgtctggtttcgcggcgcggacggccgcgcccgg
gcggtgtcgcccgccgcgctgccgccgcacgacacggcgttcgcgctgaccgtccacaaa
tcgcagggctcggaattcgacgacgcggcactgatcctgcccgcgtcgttcaatcgcgtg
ctgtcgcgcgaactcgtctacaccgcgatcacgcgcgcgcgcgcgcgcgtgcaggtgatc
ggctcgcgcgcggtgctcgcgctcgcgatcgcgacgcgcacggcgcgcgattccggcctt
gccgcacgaatcgccgatgcgctgcgcgcgcggcaggagggcgcgcgatga

DBGET integrated database retrieval system