KEGG   Burkholderia mallei NCTC 10247: BMA10247_0572Help
Entry
BMA10247_0572     CDS       T00479                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
bmn  Burkholderia mallei NCTC 10247
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bmn00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:557327..558217
Genome map
AA seq 296 aa AA seqDB search
MSSSDSVFPVPAPLQCGRFTLTFERPLVMGILNVTPDSFSDGGRYVARDAALAQAERMLA
EGADILDIGGESTRPGAPPVPLNEELERVIPLVEALRGRNVPLSIDTYKPAVMRASLAAG
ADLINDIWGLRQPGAIDAVRDSACGLCVMHMLGEPRTMQVHAPEYRDVIDDVRAFLAERA
DALVQAGVDARRISVDPGFGFGKSVIEHNYALLAHLPRTAPARPDGRAYPILAGMSRKSM
LGAVIGRPAPERIAASVAAAVCAAERGAAIVRVHDVAATVDALKVWSAVRDAARRA
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
gtgtccagttccgattccgtttttcccgttcccgcgccgctgcaatgcggccgtttcacc
ttgaccttcgagcgccccctcgtgatggggatcctcaacgtcacccccgattcgttctcc
gacggcggccgttacgtcgcccgtgacgccgcgctcgcgcaggcggagcggatgcttgcc
gaaggcgcggacatcctcgacatcggcggcgaatcgacgcgccccggcgcgccgcccgtg
ccgcttaacgaggagctcgagcgcgtgattccgctcgtcgaggcgctgcgcggccggaac
gtgccgctgtcgatcgacacgtacaagcccgccgtgatgcgcgcgtcgctcgccgcgggc
gccgatctgatcaacgatatctgggggctgcggcagccgggcgcgatcgacgcggtgcgc
gacagcgcgtgcggcctctgcgtgatgcacatgctcggcgagccgcggacgatgcaggtg
catgcgcccgagtatcgcgacgtgatcgacgacgtgcgcgcgtttctcgccgagcgcgcc
gatgcgctcgtccaggcgggcgtcgatgcccggcgtatcagcgtcgatccggggttcggt
ttcggcaagtcggtgatagaacacaactatgcgctgcttgcgcatttgccgaggaccgcg
cccgcgcggcccgacgggcgcgcgtatccgatcctcgccggcatgtcgcgcaagtcgatg
ctgggcgcggtgatcggcagacccgcgcccgagcgcatcgcggcgagcgtcgcggcggcg
gtctgcgcggccgagcggggggcggcgatcgtgcgcgtgcacgacgtcgcggcgaccgtc
gacgcattgaaagtatggagcgccgtgcgcgatgccgcgcggcgagcataa

DBGET integrated database retrieval system