KEGG   Burkholderia mallei NCTC 10247: BMA10247_0694Help
Entry
BMA10247_0694     CDS       T00479                                 

Definition
di-heme cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
bmn  Burkholderia mallei NCTC 10247
Brite
Enzymes [BR:bmn01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     BMA10247_0694
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:671180..672595
Genome map
AA seq 471 aa AA seqDB search
MMRRLPRYARQHRSFFVAPRAFAAAAALAAGVAACDANGPGASAAAAVAPAVPAASAASA
ASAASAARPAPLAQPAAPAVVDSQPQTRAQVYEAVKQMTALGRQLFFDPSLSGSGKLACA
SCHSPQHAFGPPNALPAQFGGDDLRQQGFRAVPTLKYLQKVPAFSEHYHESDDEGDESVD
AGPTGGLTWDGRVDSGAEQARVPLTSPFEMNGTPEKVARAVRAAPYAPAFRAAFGARVLD
DDRATFEAVLQALGTFEQAPDVFYPYTSKYDAYLAGRARLTRAELHGLQVFNDEKKGNCA
SCHVSRRGLDGSPPQFSDFGLIALGVPRNRALAVNRNPNFYDLGACGPERRDLKGRDEFC
GLFRTPTLRNVALKKTFFHNGVYHSLDDVLRFYAERDTHPEKFYPVKRGVVQKFDDLPKR
YWKNLNDEPPFERKRGDPPAMTDAEIRDVIAFLGTLTDGYDPRAKPAGGAR
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgccgcttgccgcgatacgcccgccagcaccgttcgttcttcgtcgcgccgcgc
gcgttcgcggccgccgccgcgcttgccgcgggcgtcgccgcgtgtgacgcgaacgggccg
ggcgcgagcgccgccgcggccgtcgcgcccgctgtcccagccgcttccgctgcttccgct
gcctccgctgcctccgctgcgcgtcccgcgcctctcgcgcagccggccgcgcccgccgtc
gtcgacagtcagccgcagacgcgcgcgcaggtgtacgaggcggtcaagcagatgacggcg
ctcggcaggcagttgttcttcgatccttcgctgtcgggcagcggcaagctcgcctgcgcg
tcgtgccacagcccgcagcacgcgttcgggccgccgaacgcgctgcccgcgcaattcggc
ggcgacgatctgcgccagcagggctttcgcgccgtgccgacgctcaaatacctgcagaag
gtgcccgcgttcagcgagcactatcacgaatcggacgacgagggcgacgagagcgtcgac
gccggcccgacgggcgggctcacgtgggacggccgcgtggacagcggcgccgagcaggcg
cgcgtgccgctcacgtcgccgttcgagatgaacggcacgcccgagaaggtcgcgcgcgcg
gtgcgggccgcgccgtacgcgcccgcgtttcgcgcggcgttcggcgcgcgcgtgctcgac
gacgaccgcgcgacgttcgaggcggtgctgcaggcgctcggcacgttcgagcaggcgccc
gacgtgttctatccgtacacgagcaagtacgacgcgtacctggcgggccgcgcgcggttg
acgcgcgccgagctgcacgggctgcaggtcttcaacgacgagaagaagggcaactgcgcg
agctgccacgtgagccggcgcgggctcgacggctcgccgccgcagttcagcgatttcggc
ctgatcgcgctcggcgtgccgcgcaatcgcgcgctcgcggtgaatcggaatccgaatttt
tacgacctcggcgcatgcgggcccgagcgccgggacctgaaggggcgcgacgagttctgc
gggctgttccgcacgccgacgctgcgtaacgtcgcgctgaagaagacgttcttccacaac
ggcgtctatcactcgctcgacgacgtgctgcgcttctacgccgagcgcgacacgcatccg
gaaaagttctatccggtgaagcgcggcgtcgttcagaagttcgacgacttgccgaagcgt
tactggaagaacctgaacgacgagccgccgttcgagcgcaagcgcggcgatccgcccgcg
atgaccgatgcggagatccgggacgtgatcgcgttcctcggcacgctcaccgacggctac
gatccgcgcgcgaagccggcaggcggcgcgcgctga

DBGET integrated database retrieval system