KEGG   Burkholderia mallei NCTC 10247: BMA10247_1001Help
Entry
BMA10247_1001     CDS       T00479                                 

Gene name
sucB
Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bmn  Burkholderia mallei NCTC 10247
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bmn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BMA10247_1001 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BMA10247_1001 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    BMA10247_1001 (sucB)
Enzymes [BR:bmn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BMA10247_1001 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:987948..989222
Genome map
AA seq 424 aa AA seqDB search
MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIELETDKVVLEVPAPAAGVLAQV
LQNDGDTVVADQVIATIDTEAKAGAAAAAAGAADVQSAAAPVAAPAPAAQPAAAASSTAA
TSPAASKLMAEKGIGAGDVAGSGRDGRITKGDVLSAGSAPKAAPAAAPAKAAAKPALPEV
KVPASATTWLNDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMQPVMDLRAKYK
DKFEKEHGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAVGSPRGLVV
PILRNADQLSLAEIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGSMLSTPIINPP
QSAILGVHATKERPVVENGQIVIRPINYLALSYDHRIIDGREAVLSLVAMKDALEDPARL
LLDL
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgtagaagtcaaagtcccccagctttcggagtcggtttcggaagcgaccatg
ctgcagtggaagaagaagcccggcgaagccgtcgcgcaggacgaaatcctgatcgagctc
gagacggacaaggtcgtcctcgaagtgccggcgccggccgcgggcgtgctcgcgcaagtg
ctgcagaacgacggtgacacggtcgtcgccgaccaggtgatcgcgaccatcgacaccgaa
gcgaaggcaggcgccgccgcggcagcggcaggcgccgccgacgttcagtcggccgccgct
cccgtcgccgcgccggcgcccgccgcgcagccggccgccgccgcgtcgagcaccgcggcc
acatcgcccgccgcgtcgaagctgatggccgagaagggcatcggcgccggcgacgtcgcc
ggctcgggccgcgacggccgcatcacgaagggcgacgtgctgtccgcgggcagcgcgccg
aaggccgcgccggccgccgcgccggcgaaggccgccgcgaagccggcgctgccggaagtg
aaggtgccggcatcggcgacgacgtggctcaacgaccgtccggagcagcgcgtgccgatg
tcgcgcctgcgcgcgcgcatcgccgagcgtctgctcgaatcgcagcagaccaacgcgatc
ctcacgacgttcaacgaagtgaacatgcagccggtgatggacctgcgcgcgaagtacaag
gacaagttcgagaaggagcacggcgtgaagctcggcttcatgtcgttcttcgtgaaggcg
gccgttcacgcgctgaagaagttcccgctcgtgaacgcgtcgatcgacggcaacgacatc
gtctaccacggctacttcgacatcggcatcgcggtcggttcgccgcgcggcctcgtcgtg
ccgatcctgcgcaacgcggatcagctgagcctcgccgagatcgagaagaagatcgccgaa
ttcggccagaaggcaaaggacggcaagctgtcgatcgaggaaatgacgggtggcacgttc
tcgatctcgaacggcggcgtgttcggctcgatgctgtcgacgccgatcatcaacccgccg
cagtcggcgatcctcggcgtgcacgcgacgaaggagcgcccggtcgtcgagaacggccag
atcgtgatccgcccgatcaactatcttgcgctgtcgtacgaccaccggatcatcgacggt
cgcgaagcggtgctgtcgcttgtcgcgatgaaggacgcgctcgaagatccggcgcgcctg
ctgctcgacctgtaa

DBGET integrated database retrieval system