KEGG   Burkholderia mallei NCTC 10247: BMA10247_1118Help
Entry
BMA10247_1118     CDS       T00479                                 

Gene name
pcm
Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bmn  Burkholderia mallei NCTC 10247
Brite
Enzymes [BR:bmn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     BMA10247_1118 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 NodS Methyltransf_11 Methyltransf_23 RrnaAD Methyltransf_31
Motif
Other DBs
NCBI-ProteinID: ABO03951
UniProt: A3MK86
Position
I:complement(1112398..1113393)
Genome map
AA seq 331 aa AA seqDB search
MGACRERRFMSGERAKRFPLALEDLKREPRKPEGRVAERQAAGDAARQRLTAAAAVPAAA
SPIVPERRAPHGGVFAAKPARAKQHAPAAPGAAKRAPQGGAKQGDRSAAPNVALSGALAL
TSERVRERMVERLRANGVADPRVLAAMSAVPRHMFVDPGLAAQAYEDAALPIGHQQTISK
PSVVARMIELAAAGRALERVLEIGTGCGYQAAVLSRVARDVYSIERVRPLYERAKLNLRP
LRVPNIRLHYGDGRVGLPAAAPFDAIVIAAAGLDVPRALLEQLAIGGRLVAPVGEQAGEQ
VLTLVERVAPAQWRESRLDRVFFVPLKSGVI
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
ttgggcgcgtgccgggagcggcgcttcatgagcggcgagcgcgcgaagcggtttccgctc
gcgctcgaggatctgaagcgcgagccgcgcaagcccgagggccgcgtggcggagcgccag
gcggcgggagacgccgcccgccagcgcctcaccgcggccgccgccgtgcccgccgctgct
tctccgatcgtgcccgaacgccgcgcgccgcacggcggcgtgttcgccgcgaaacccgcg
cgtgcgaagcagcacgcgcctgcggcgcccggcgccgcgaagcgcgcgccgcaggggggc
gcgaagcagggggaccggagcgccgcgccgaacgtcgcgctgagcggcgcgctcgcgctg
acttcggaacgtgtgcgcgagcgcatggtcgaacggctgcgggcaaacggcgtggccgat
ccgcgcgtgctcgccgcgatgtcggccgtgccgcgccacatgttcgtcgatcccgggctc
gcggctcaggcgtacgaggacgccgcgctgccgatcggccatcagcagacgatctcgaag
ccgtcggtcgtcgcgcgcatgatcgagctcgcggcggcgggccgcgcgctcgagcgcgtg
ctcgaaatcggcacgggctgcggctatcaggccgcggtgctgagccgcgtcgcgcgcgac
gtgtattcgatcgagcgcgtgaggccgctctacgagcgcgcaaaactgaatttgcggccg
ctgcgcgtgccgaacatccgcctgcactacggcgacggacgcgtgggcctgcccgccgcg
gcgccgttcgacgcgatcgtgatcgcggcggcggggctcgacgtgccgcgggcgctgttg
gaacaattggcgatcggcggcaggctcgtcgcgcctgtcggagagcaggcgggcgagcag
gtgctgacgctcgtggagcgcgtcgcacccgcgcagtggcgcgagtcgcggcttgatcgc
gttttctttgtccctttaaaatccggagtgatttga

DBGET integrated database retrieval system