KEGG   Burkholderia mallei NCTC 10247: BMA10247_1219Help
Entry
BMA10247_1219     CDS       T00479                                 

Definition
acyl-CoA thioesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
bmn  Burkholderia mallei NCTC 10247
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:bmn00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    BMA10247_1219
Enzymes [BR:bmn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     BMA10247_1219
   3.1.2  Thioester hydrolases
    3.1.2.-  
     BMA10247_1219
Lipid biosynthesis proteins [BR:bmn01004]
 Fatty acid synthase
  Component type
   BMA10247_1219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1206375..1207055
Genome map
AA seq 226 aa AA seqDB search
MSMKRTVHWKAGATLAVVATFAGPASAATNAAPAPNADGGKPVIVVLGDSLSAEYGLPRD
TGWVALMRARLAAERIDYSVANASISGDTTSGGRARLPAVLARLKPAVVVVELGANDALR
GVPLAATEGNLREIVAQARQARAQVLLVGMYVPSNYGPDYTQKFHGVYTGLSKEMRVPLV
PFLLAGIENKPDMFQADQIHPTQAAQRQLLDNVWPALKPLLRTSSR
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
ttgagcatgaaacgcacagttcactggaaggccggcgcgacgctcgccgtggtcgcgacg
ttcgccggcccggcatccgccgccacgaatgcagcgcccgcgccgaacgccgacggcggc
aagccggtgatcgtcgtgctcggcgacagcctgtcggccgaatacggcctgccgcgcgat
acgggctgggtcgcgctgatgcgcgcgcgcctcgcggccgagcgaatcgattatagcgtc
gcgaacgcgagcatctccggcgacacgacgagcggcggccgcgcgcggctgcccgcggtg
ctcgcacggctcaagccggccgtcgtcgtcgtcgaactcggcgcgaacgacgcgctgcgc
ggcgtgccgctcgccgcgaccgaaggcaacctgcgcgagatcgtcgcgcaggcgcggcag
gcgcgcgcgcaggtgctgctcgtcggcatgtacgtgccgtcgaattacggcccggactac
acgcaaaagttccacggcgtctacacggggctgtccaaggagatgcgcgtgccgctcgtg
ccgttcctgctcgccggcatcgagaacaagcccgacatgttccaggccgaccagatccat
ccgacgcaggccgcgcagcgccagttgctcgacaacgtatggccggccctcaagccgctg
ctgcggacgtcatcgcgctga

DBGET integrated database retrieval system