KEGG   Burkholderia mallei NCTC 10247: BMA10247_1219Help
Entry
BMA10247_1219     CDS       T00479                                 

Definition
acyl-CoA thioesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
bmn  Burkholderia mallei NCTC 10247
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:bmn01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1206375..1207055
Genome map
AA seq 226 aa AA seqDB search
MSMKRTVHWKAGATLAVVATFAGPASAATNAAPAPNADGGKPVIVVLGDSLSAEYGLPRD
TGWVALMRARLAAERIDYSVANASISGDTTSGGRARLPAVLARLKPAVVVVELGANDALR
GVPLAATEGNLREIVAQARQARAQVLLVGMYVPSNYGPDYTQKFHGVYTGLSKEMRVPLV
PFLLAGIENKPDMFQADQIHPTQAAQRQLLDNVWPALKPLLRTSSR
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
ttgagcatgaaacgcacagttcactggaaggccggcgcgacgctcgccgtggtcgcgacg
ttcgccggcccggcatccgccgccacgaatgcagcgcccgcgccgaacgccgacggcggc
aagccggtgatcgtcgtgctcggcgacagcctgtcggccgaatacggcctgccgcgcgat
acgggctgggtcgcgctgatgcgcgcgcgcctcgcggccgagcgaatcgattatagcgtc
gcgaacgcgagcatctccggcgacacgacgagcggcggccgcgcgcggctgcccgcggtg
ctcgcacggctcaagccggccgtcgtcgtcgtcgaactcggcgcgaacgacgcgctgcgc
ggcgtgccgctcgccgcgaccgaaggcaacctgcgcgagatcgtcgcgcaggcgcggcag
gcgcgcgcgcaggtgctgctcgtcggcatgtacgtgccgtcgaattacggcccggactac
acgcaaaagttccacggcgtctacacggggctgtccaaggagatgcgcgtgccgctcgtg
ccgttcctgctcgccggcatcgagaacaagcccgacatgttccaggccgaccagatccat
ccgacgcaggccgcgcagcgccagttgctcgacaacgtatggccggccctcaagccgctg
ctgcggacgtcatcgcgctga

DBGET integrated database retrieval system