KEGG   Burkholderia mallei NCTC 10247: BMA10247_1343Help
Entry
BMA10247_1343     CDS       T00479                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bmn  Burkholderia mallei NCTC 10247
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bmn01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:bmn00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1326974..1328113
Genome map
AA seq 379 aa AA seqDB search
MSATLALTEQLIARASVTPDDQHCQQLMIERLAALGFECETIASHGVTNFWAVKRGTAGR
AGKLLAFAGHTDVVPTGPLEQWRSPPFVPTHRDGKLYGRGAADMKTSLAGFVVAAEEFVA
AHPQHRGSIGFLITSDEEGPATDGTVKVVEALAARGERLDYCIVGEPTSTATLGDVVKNG
RRGSMSGELVVKGVQGHIAYPHLAKNPIHLLAPALAELAAEQWDEGNEYFPPTTWQVSNL
RAGTGATNVIPGHADLLFNFRFSTASTVEGLQARVHAILDRHGLDYTLNWSVSGLPFLTP
RGELSNALDAAIRAETGVSPELSTTGGTSDGRFIARICPQVIEFGPPNASIHKIDEHIDV
RFVDPLKNVYRRVLEQLIA
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccacccttgccctcaccgaacagttgatcgcgcgcgcgtccgtcacgcccgac
gatcagcactgccagcaattgatgatcgagcgcctcgccgccctcggcttcgagtgcgaa
acgatcgcgtcgcacggcgtgacgaacttctgggccgtcaagcgcggcacggccggccgc
gcaggcaagctgctcgcgttcgcgggccataccgacgtcgtgccgaccggcccgctcgag
cagtggcgctcgccgccgttcgtgccgacgcaccgcgacggcaagctgtacggccgcggc
gcggccgacatgaaaacctcgctcgcgggcttcgtcgtcgcggccgaggagttcgtcgcc
gcgcatccgcagcaccgcggctcgatcggtttcctgatcacgagcgacgaggaaggcccg
gccaccgacggcaccgtgaaagtcgtcgaggcgctcgccgcgcgcggcgagcgcctcgat
tactgcatcgtcggcgaaccgacctcgacggcgacgctcggcgacgtcgtgaagaacggc
cggcgcggctcgatgtcgggcgagctcgtcgtcaagggcgtgcaaggccatatcgcgtat
ccgcatctcgcgaagaacccgatccatctgctcgcgccggcgctcgccgagctcgccgcc
gagcaatgggacgaaggcaacgagtactttccgccgaccacctggcaggtgtcgaacctg
cgcgcgggcaccggcgcgacgaacgtgattccgggccacgccgatctgctgttcaacttc
cgcttctcgacggcgagcacggtcgagggcctgcaggcgcgcgtgcacgcgatcctcgac
aggcacgggctcgattacacgctgaactggtcggtgagcggcctgccgttcctcacgccg
cgcggcgagctgtcgaacgcgctcgacgccgcgatccgcgcggaaacgggcgtctcgccc
gagctgtcgacgacgggcggcacgtccgacggccgcttcatcgcgcgcatctgcccgcag
gtgatcgagttcggcccgccgaacgcgagcatccacaagatcgacgagcacatcgacgtg
cgcttcgtcgacccgctgaagaacgtgtaccgccgcgtgctcgaacaactgatcgcctga

DBGET integrated database retrieval system