KEGG   Burkholderia mallei NCTC 10247: BMA10247_1501Help
Entry
BMA10247_1501     CDS       T00479                                 

Gene name
aceF
Definition
(GenBank) dihydrolipoyllysine-residue acetyltransferase E2 component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bmn  Burkholderia mallei NCTC 10247
Pathway
bmn00010  Glycolysis / Gluconeogenesis
bmn00020  Citrate cycle (TCA cycle)
bmn00620  Pyruvate metabolism
bmn01100  Metabolic pathways
bmn01110  Biosynthesis of secondary metabolites
bmn01120  Microbial metabolism in diverse environments
bmn01130  Biosynthesis of antibiotics
bmn01200  Carbon metabolism
Module
bmn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bmn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMA10247_1501 (aceF)
   00020 Citrate cycle (TCA cycle)
    BMA10247_1501 (aceF)
   00620 Pyruvate metabolism
    BMA10247_1501 (aceF)
Enzymes [BR:bmn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BMA10247_1501 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N HlyD_D23 NQRA
Motif
Other DBs
NCBI-ProteinID: ABO03976
Position
I:complement(1490568..1492157)
Genome map
AA seq 529 aa AA seqDB search
MSQAIEVKVPDIGDYKDVPVIEVLVKPGDAVEPEQSLVTLESDKATMDVPSPSAGTVKEV
KVKVGDAVSQGSLIVLLDGAQAAAQPAQANGAATSAAQPAAAPAAAPAPAAAAGGGTVDV
KVPDIGDYKDVPVIEIAVKIGDTVEKEQSLVTLESDKATMDVPSPAAGVVKDIKVKVGDA
VSEGSLIVVLEASGGAAASAPQAAPAAAPAPAQAPAPAASGEYRASHASPSVRKFARELG
VDVSRVTGTGPKSRITKDDVTAFVKGVMTGQRAAPGAAAAPAGGGELNLLPWPKVDFSKF
GPFEAKPLSRIKKISGANLHRNWVMIPHVTNNDEADITELEALRVQLNKEHEKAGVKFTM
LAFVIKAVVAALKKFPTFNASLDGDNLVFKQYYHIGFAADTPNGLVVPVIRDADKKGLVD
IAKEMAELSKAAREGKLKPDQMQGGCFSISSLGGIGGTHFTPIINAPEVAILGLSRGQMK
PVWDGKQFVPRLTLPLSLSYDHRVIDGAEAARFNAYLGALLADFRRIIL
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaagcgatcgaagtcaaggtgccggatatcggcgattacaaggacgtgcccgtc
atcgaagtgctcgtgaagccgggcgatgcggtcgagcccgagcagtcgctcgtcacgctc
gaatcggacaaggcgacgatggatgtgccgagcccgtcggcgggcacggtcaaggaagtg
aaggtgaaggtcggcgacgcggtgtcgcaaggctcgctgatcgtgctgctcgacggcgcg
caggcggcggcccagcccgcgcaggcgaacggcgccgcgacgagcgccgcgcagccggcg
gcggcgcccgctgccgcgcctgcgccggcggcggccgcgggcggcggcacggtcgacgtg
aaggtgccggacatcggcgactacaaggacgtgcccgtcatcgagatcgccgtgaagatc
ggcgacacggtcgagaaggagcagtcgctcgtcacgctcgaatcggacaaggcgacgatg
gacgtgccgagcccggccgcgggcgtcgtcaaggacatcaaggtaaaggtcggcgatgcg
gtgtcggaaggttcgctgatcgtcgtgctcgaagcgtcgggcggcgccgccgcgagcgcg
ccgcaggccgcacccgcggctgcgccggcccccgcgcaggcaccggcacccgccgcgagc
ggcgagtaccgcgcgagccacgcgtcgccgtcggtgcgcaagttcgcgcgcgagctcggc
gtcgacgtgtcgcgcgtcacgggcacggggccgaagagccgcatcacgaaggacgacgtc
accgcgttcgtgaagggcgtgatgacggggcagcgcgcggcgcccggcgctgcggccgcg
cccgcgggcggcggcgagctgaacctgctgccgtggccgaaggtcgacttctcgaagttc
ggcccgttcgaggcgaagccgctgtcgcgcatcaagaagatctcgggcgcgaacctgcat
cgcaactgggtgatgatcccgcacgtcacgaacaacgacgaggcggacatcaccgagctc
gaagcgctgcgcgtgcaactgaacaaggagcacgagaaggcgggcgtgaagttcacgatg
ctcgcgttcgtgatcaaggcggtcgtcgccgcgctgaagaagttcccgaccttcaacgcg
agcctcgacggcgacaacctcgtgttcaagcagtactaccacatcggtttcgccgccgac
acgccgaacggcctcgtcgtgccggtgatccgcgacgcggacaagaaggggctcgtcgac
atcgcgaaggaaatggccgagctgtcgaaggccgcgcgcgaaggcaagctcaagccggac
cagatgcagggcggctgcttctcgatctcgtcgctcggcgggatcggcggcacgcacttc
acgccgatcatcaatgcgccggaagtggcgatcctcgggctgtcgcgcggccagatgaag
ccggtgtgggacggcaagcagtttgtgccgcgcctcacgctgccgctgtcgctgtcgtat
gaccatcgcgtgatcgatggcgcggaagccgcgcggttcaatgcgtatctcggcgcgttg
cttgccgatttccgtcgcatcattctttga

DBGET integrated database retrieval system