KEGG   Burkholderia mallei NCTC 10247: BMA10247_1502Help
Entry
BMA10247_1502     CDS       T00479                                 

Gene name
aceE
Definition
pyruvate dehydrogenase subunit E1 (EC:1.2.4.1)
Orthology
K00163  
pyruvate dehydrogenase E1 component [EC:1.2.4.1]
Organism
bmn  Burkholderia mallei NCTC 10247
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bmn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BMA10247_1502 (aceE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMA10247_1502 (aceE)
   00020 Citrate cycle (TCA cycle)
    BMA10247_1502 (aceE)
   00620 Pyruvate metabolism
    BMA10247_1502 (aceE)
Enzymes [BR:bmn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     BMA10247_1502 (aceE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(1492290..1494965)
Genome map
AA seq 891 aa AA seqDB search
MMKYVAAERDDDAQETVEWLEALDGVISSVGPGRAHYLIEKQIEFARMHGEHLPFSANTP
YINTIPVEAQAKIPGDQDIEHRIRSYTRWNAIAMVLRAGKHTNVGGHIASFASAATLYDV
GYNHFWHAPSAEHGGDLVFVQGHSSPGIYSRAFLLGRLTEDQLDNFRQEVGGNGISSYPH
PWLMPDFWQFPTVSMGLGPIMAIYQARFMKYLQARGIVKTEGRKVWAFLGDGETDEPESL
GAIGMASREKLDNLVFVINCNLQRLDGPVRGNGKIIQELESEFRGAGWNVIKVIWGSRWD
ALFARDKTGALMRRMMEAVDGEYQTYKSESGAYVREHFFNTPELKALVADWSDDDIWNLN
RGGHDPHKIYAAFHEASNSKGAPTVILAKTIKGYGMGEAGQAMNITHQQKKLPVEQLKKF
RDQFRLPIADDVIADVPYLKFDEGSKELEYMRAHRQALGGYLPQRRQKAQSLPVPALDAF
EPLLKGTGEGREISTTMAFVRILNILLKDKALGKRVVPIVPDESRTFGMEGLFRQIGIWN
QEGQKYVPEDSDQLMFYKESETGQILQEGINEAGGMCDWIAAATSYSTHGEIMVPFYIFY
SMFGFQRIGDLAWAAGDMRSRGFLLGGTAGRTTLNGEGLQHEDGHSLMWAASVPNCVSYD
PTFGYELAVIVQDGLRRMVQEQEDVYYYVTVMNENYEHPAIPQGEHVAADIIKGMYAFRK
ADADKKAPRVQLLGAGTIFNEVIAAADLLKNDWGVAADLWSVPSFTELAREGHDVERWNL
LHPAEARRLSHVQTCLKDTQGPVIASTDYVRALADQIRGQIDRRYVVLGTDGFGRSDTRG
ALRHFFEVDRYWVTVAALNALADEGTIERKVVADAIAKYNLDPAKPNPMTV
NT seq 2676 nt NT seq  +upstreamnt  +downstreamnt
gtgatgaagtacgtcgcagccgaacgcgacgacgacgcgcaggaaaccgtcgaatggctc
gaagcgctcgacggcgtgatttcgtcggtcggccccggccgcgcgcactacctgatcgaa
aagcagatcgaattcgcgcgcatgcacggcgagcacttgccgttctccgcgaacaccccg
tacatcaacacgattcccgtcgaagcccaggcgaagattccgggcgaccaggacatcgag
caccggatccgctcgtacacgcgctggaacgcgatcgcgatggtgctgcgcgcgggcaag
cacacgaacgtcggcggccacatcgcgtcgttcgcttcggccgcgacgctctatgacgtc
ggctacaaccacttctggcacgcgccgtccgccgagcacggcggcgatctcgtgttcgtg
cagggccactcgtcgcccggcatttattcgcgcgcgttcctgctcggccgcctgacggaa
gatcagctcgacaacttccgccaggaagtgggcggcaacggcatctcgtcgtatccgcac
ccgtggctgatgccggatttctggcagttcccgaccgtgtcgatgggcctcggtcccatc
atggcgatctatcaggcgcgcttcatgaagtacctgcaggcgcgcgggatcgtgaagacg
gaaggccgcaaggtctgggcgttcctcggcgacggcgagaccgacgagccggaatcgctc
ggcgcgatcggcatggcgagccgcgagaagctcgataacctcgtgttcgtgatcaactgc
aacctgcagcgtctcgacggcccggtgcgcggcaacggcaagatcatccaggagctcgaa
tcggagttccgcggcgccggctggaacgtgatcaaggtgatctggggcagccgctgggat
gcgctgttcgcgcgcgacaagacgggcgcgctgatgcgccggatgatggaagccgtcgac
ggcgagtatcagacgtacaagtcggagtcgggcgcgtacgtgcgcgagcacttcttcaac
acgccggagctgaaggcgctcgtcgccgactggtccgacgacgacatctggaacctgaac
cgcggcggccacgatccgcacaagatctacgcggcgttccacgaggcgagcaattcgaag
ggcgcgccgacggtgatcctcgcgaagacgatcaagggctacgggatgggcgaagccggc
caggcgatgaacatcacgcaccagcagaagaagttgcccgtcgagcaactgaagaagttc
cgcgaccagttccgcctgccgatcgccgacgacgtgatcgccgacgtgccgtacctgaag
ttcgacgaaggctcgaaggaactcgagtacatgcgcgcgcaccgccaggcgctcggcggc
tatctgccgcagcgccgccagaaggcgcaatcgctgccggtgccggcgctcgacgcgttc
gagccgctgctcaagggcacgggcgaaggccgcgagatctcgacgacgatggcgttcgtg
cggatcctgaacatcctgctgaaggacaaggcgctcggcaagcgcgtcgtgccgatcgtg
ccggacgaatcgcgcacgttcggcatggagggcctgttccgccagatcggcatctggaac
caggaaggccagaagtatgtgccggaagattccgatcaactgatgttctacaaggaatcg
gaaaccggccagatcctgcaggaaggcatcaacgaagcgggcggcatgtgcgactggatc
gcggcggcgacgtcgtactcgacgcacggcgagatcatggtgccgttctatatcttctat
tcgatgttcggcttccagcgcatcggcgatctcgcgtgggcggcgggcgacatgcgctcg
cgcggtttcctgctcggcggcaccgcgggccgcacgacgctcaacggcgaaggcctgcag
cacgaagacggccactcgctgatgtgggcggcttcggtgccgaactgcgtgagctacgat
ccgacgttcggctacgagctcgccgtcatcgtgcaggacggcctgcgccggatggtgcag
gagcaggaggacgtctactactacgtgacggtgatgaacgagaactacgagcacccggcg
attccgcagggcgagcacgtggcggccgacatcatcaagggcatgtacgcgttcaggaaa
gccgacgccgacaagaaggcgccgcgcgtgcaactgctcggcgcgggcacgatcttcaac
gaagtgatcgccgcggcggacctgctgaagaacgactggggcgtcgccgccgatctctgg
agcgtgccgagcttcaccgagctcgcgcgcgaaggccatgacgtcgagcgctggaacctg
ctgcatccggccgaggcgcgccgcctgtcgcacgtgcagacgtgcctgaaggacacgcag
ggcccggtgatcgcgtcgaccgactacgtccgcgcgctcgccgaccagatccgcggccag
atcgaccgccgctacgtcgtgctcggcaccgacggcttcggccgctcggacacgcgcggc
gcgctgcgccacttcttcgaggtggaccgctactgggtcacggtcgcggcgctcaacgcg
ctcgccgatgaaggcacgatcgagcgcaaggtcgtcgccgacgccatcgcgaagtacaac
ctcgacccggccaagcccaacccgatgacggtttaa

DBGET integrated database retrieval system