KEGG   Burkholderia mallei NCTC 10247: BMA10247_1652Help
Entry
BMA10247_1652     CDS       T00479                                 

Gene name
holC
Definition
DNA polymerase III subunit chi (EC:2.7.7.7)
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
bmn  Burkholderia mallei NCTC 10247
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:bmn00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BMA10247_1652 (holC)
   00240 Pyrimidine metabolism
    BMA10247_1652 (holC)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    BMA10247_1652 (holC)
   03430 Mismatch repair
    BMA10247_1652 (holC)
   03440 Homologous recombination
    BMA10247_1652 (holC)
Enzymes [BR:bmn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     BMA10247_1652 (holC)
DNA replication proteins [BR:bmn03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     BMA10247_1652 (holC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(1647916..1648332)
Genome map
AA seq 138 aa AA seqDB search
MTRIDFHTNVGDSLAYACRLLRKAYQAGQPVVVCAEPARLRALDERLWTFSPLDFIPHCA
IDNAHAASTPIVLTADLERAPHHGILLNLGAQVPAQFARFERLLEVVGNPPDELAAGRDR
YRFYRDRGYALNNHKQGG
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgacgcggatcgatttccatacgaatgtcggcgattcgctcgcgtacgcgtgccggctg
ctgcgcaaggcgtatcaggcggggcagcccgtcgtcgtgtgcgcggagcccgcgcggctg
cgcgcgctcgacgagcgtctgtggacgttctcgccgctcgatttcattccgcattgcgcg
atcgacaacgcgcacgcggcgagcacgccgatcgtgctgaccgcggatctcgagcgcgcg
ccgcatcacgggatcctgctgaacctgggcgcgcaggtgccggcgcagttcgcacgcttc
gagcgcctgctcgaggtggtcggcaacccgcccgacgagctcgcggccggccgcgaccgg
tatcggttctatcgcgatcgcggctacgcgctcaacaatcacaagcagggcggctag

DBGET integrated database retrieval system