KEGG   Burkholderia mallei NCTC 10247: BMA10247_1856Help
Entry
BMA10247_1856     CDS       T00479                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bmn  Burkholderia mallei NCTC 10247
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmn00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BMA10247_1856 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BMA10247_1856 (pyrB)
Enzymes [BR:bmn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     BMA10247_1856 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(1837977..1839062)
Genome map
AA seq 361 aa AA seqDB search
MRVAHPGAVWQHVGITHIMTTDTSGRTGNPAAAAPAERFRYGFLKGNPQLTKNGELKHLL
TIEGLPRAILNQILDTAEQFVSVTDREVKKVPLLRGKSVFNLFFENSTRTRTTFEIAAKR
LSADVINLNINASSTSKGESLLDTINNLSAMHADLFVVRHASSGAPYLIAEHCAPHVHVI
NAGDGRHAHPTQGLLDMYTIRHYKRDFTKLRVAIVGDILHSRVARSDIHALTTLGVPEVR
AIGPRTLLPGGLEQMGVRVFHNLDEGLRDVDVIIMLRLQNERMSGALLPSAQEYFKSWGL
TPERLALAAPDAIVMHPGPMNRGVEIDSQVADGPQSVILNQVTFGIAVRMAVMGIVAGTS
D
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgtcgcgcatccgggcgccgtttggcaacacgttggaatcacgcacatcatgacg
accgacacctccggccgcaccggcaatcccgccgcggccgcgcccgccgagcgctttcgc
tatggctttctgaagggcaacccgcagctcacgaagaacggcgagctcaagcatctgttg
acgatcgagggcctgccgcgcgcgatcctcaatcagattctcgacaccgccgagcagttc
gtcagcgtgaccgaccgcgaagtgaagaaggtgccgctcttgcgcggcaaatcggtattc
aacctgttcttcgagaattcgacgcgcacgcgcacgacgttcgagatcgccgcgaagcgg
ctgtccgccgacgtgatcaacctgaacatcaacgcgtcgtcgacgagcaagggcgagtcg
ctcctcgacacgatcaacaatctgtcggcgatgcacgccgatctcttcgtcgtgcgccac
gcatcgagcggcgcgccgtacctgatcgccgagcactgcgcgccgcacgtgcacgtgatc
aacgcgggcgacggccgtcacgcgcacccgacgcagggccttctcgacatgtacacgatc
cgccactacaagcgcgacttcacgaagctgcgcgtcgcgatcgtcggcgacattctccat
tcgcgcgtcgcgcgctcggacattcacgcgctgacgacgctcggcgtgcccgaggtgcgc
gcgatcggcccgcgcacgctgctgccgggcgggctcgagcagatgggcgtgcgcgtgttc
cacaatctcgacgaaggcctgagggacgtcgacgtgatcatcatgctgcgcctgcagaac
gagcggatgagcggcgcgctgctgccgtccgcgcaggaatatttcaagagctggggcttg
acgcccgagcgccttgcgctcgccgcgcccgacgcgatcgtgatgcacccggggccgatg
aaccgcggcgtcgagatcgattcgcaagtggccgacggcccgcaatcggtgatcctgaac
caggtgacgttcggcatcgcggtgcgcatggccgtgatgggcatcgtcgcgggcacgagc
gactga

  All links  
No link information was found.   
DBGET integrated database retrieval system