KEGG   Burkholderia mallei NCTC 10247: BMA10247_1889Help
Entry
BMA10247_1889     CDS       T00479                                 

Definition
hypothetical protein
Organism
bmn  Burkholderia mallei NCTC 10247
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(1868871..1869008)
Genome map
AA seq 45 aa AA seqDB search
MPCADAAHGENAWSARRITVAFPAKRADEIIRFNRRNLSFYSRGQ
NT seq 138 nt NT seq  +upstreamnt  +downstreamnt
gtgccgtgcgccgatgccgcgcatggcgaaaatgcttggagtgcgcgtcgcataacggtc
gcgttcccggcgaagcgcgccgatgaaatcatccgtttcaatcggcggaatttatcgttc
tattcgagagggcaataa

DBGET integrated database retrieval system