KEGG   Burkholderia mallei NCTC 10247: BMA10247_2002Help
Entry
BMA10247_2002     CDS       T00479                                 

Definition
(GenBank) glucokinase/transcriptional regulator, RpiR family, fusion
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
bmn  Burkholderia mallei NCTC 10247
Pathway
bmn00010  Glycolysis / Gluconeogenesis
bmn00052  Galactose metabolism
bmn00500  Starch and sucrose metabolism
bmn00520  Amino sugar and nucleotide sugar metabolism
bmn00521  Streptomycin biosynthesis
bmn01100  Metabolic pathways
bmn01110  Biosynthesis of secondary metabolites
bmn01120  Microbial metabolism in diverse environments
bmn01130  Biosynthesis of antibiotics
bmn01200  Carbon metabolism
Module
bmn_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bmn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMA10247_2002
   00052 Galactose metabolism
    BMA10247_2002
   00500 Starch and sucrose metabolism
    BMA10247_2002
   00520 Amino sugar and nucleotide sugar metabolism
    BMA10247_2002
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BMA10247_2002
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    BMA10247_2002
Enzymes [BR:bmn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BMA10247_2002
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase HTH_6 SIS SIS_2 ROK LacI HTH_IclR
Motif
Other DBs
NCBI-ProteinID: ABO04036
Position
I:1970450..1972312
Genome map
AA seq 620 aa AA seqDB search
MADVGGTNARFALETGPGEITQIRVYPGAEYPTLTDAIRKYLKDAKIGRVNHAAIAIANP
VDGDQVRMTNHNWSFSIEATRRALGFDTLLVVNDFTALAMALPGLTDAQRVQIGGGTRRQ
NSVIGLMGPGTGLGVSGLIPADDRWIALGSEGGHATFAPMDEREDLVLQYARRKYPHVSF
ERVCAGPGMEIIYRALAARDKKRIAANVDTADIVERAHAGDALALEAVECFCAILGTFAG
NLAVTLGALGGIYIGGGVVPKLGELFMRSPFRARFEAKGRFEAYLANIPTYLITAEYPAF
LGVSAILAEQLSNRTGGASSAVFERIRQMRDALTPAERRVADLALNHPRSIINDPIVDIA
RKADVSQPTVIRFCRSLGCQGLSDFKLKLATGLTGTIPMSHSQVHLGDTATDFGAKVLDN
TVSAILQLREHLNFEHVEQAIDILNNARRIEFYGLGNSNIVAQDAHYKFFRFGIPTIAYG
DLYMQAASAALLGKGDVIVAVSKSGRAPELLRVLDVAMQAGAKVIAITSSNTPLAKRATV
ALETDHIEMRESQLSMISRILHLVMIDILAVGVAIRRAAPNAELAEAMARAKARAGASAG
DEAADVLDWLSHGAAPAAKD
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
ttggccgacgtcggcggcacgaacgcgcgcttcgcgctcgagacgggcccgggagaaatc
acgcagatccgcgtgtacccgggcgccgagtatccgacgctcaccgacgcgatccgcaag
tatctgaaggacgcgaagatcggccgcgtgaatcacgcggcgatcgcgatcgcgaacccc
gtcgacggcgatcaggtccggatgacgaatcacaactggagcttctcgatcgaggcgacg
cgccgcgcgctcggcttcgatacgctgctcgtcgtcaacgatttcaccgcgctcgcgatg
gcgctgcccggcctgaccgatgcgcagcgcgtacagatcggcggcggcacgcgccgacag
aacagcgtgatcggcctgatggggccgggcacggggctcggcgtgtcggggctcattccc
gccgacgaccgctggatcgcgctcggcagcgaaggcggccacgcgacgttcgcgccgatg
gacgagcgcgaggatctcgtgctgcaatacgcgcgccgcaagtatcctcacgtgtcgttc
gagcgcgtatgcgcgggcccgggcatggagatcatctatcgcgcgctcgccgcgcgcgac
aagaagcgtatcgccgcgaacgtcgacacggccgacatcgtcgagcgcgcgcacgcgggc
gatgcgctcgcgctcgaggcggtcgagtgcttctgcgcgattctcggcacgttcgccggc
aacctcgcggtcacgctcggcgcgttgggcggcatctatatcggcggcggcgtcgtgccg
aagctcggcgagctgttcatgcgctcgccgtttcgcgcgcgcttcgaggcgaagggccgc
ttcgaggcgtatctcgcgaacatcccgacctacctgatcaccgcggaatacccggcgttt
ctcggcgtatcggcgatcctcgccgagcaactgtcgaaccgcacgggcggcgcgtcgtcg
gccgtgttcgagcgcatccgccagatgcgcgacgcgttgacgcccgccgagcggcgcgtc
gccgatctcgcgctcaaccatccgcgctcgatcatcaacgatccgatcgtcgacatcgcg
cgcaaggccgacgtgagccagcccaccgtgatccgcttctgccgctcgctcggctgccag
gggctgtcggacttcaagctgaagctcgcgacgggcctcaccggcacgatcccgatgagc
cacagccaggtgcatctgggcgacaccgcgaccgatttcggcgcgaaggtgctcgacaac
acggtatcggcgatccttcagttgcgcgagcatctgaacttcgagcacgtcgagcaggcg
atcgacatcctgaacaatgcgcggcgcatcgagttctacggcctgggcaattcgaacatc
gtcgcgcaggacgcgcactacaagttcttccgcttcgggattccgacgatcgcgtacggc
gacctgtacatgcaggcggcgtcggccgcgctcctcggcaagggcgacgtgatcgtcgcg
gtgtcgaagtcggggcgcgcgccggagctgttgcgcgtgctcgacgtcgcgatgcaggcg
ggcgcgaaggtgatcgcgatcacgtcgagcaacacgccgctcgccaagcgcgcgacggtc
gcgctcgagaccgatcacatcgagatgcgcgagtcgcagttgtcgatgatctcgcggatc
ctgcatctcgtgatgatcgacatcctcgcggtcggcgtcgcgatccgccgcgccgcgccg
aacgcggagctcgcggaggcgatggcgcgcgcgaaggcgcgcgcgggcgcgagcgcgggc
gacgaggccgccgacgtgctcgactggctgagccacggcgcggcgcccgcggcgaaggac
tga

DBGET integrated database retrieval system