KEGG   Burkholderia mallei NCTC 10247: BMA10247_2002Help
Entry
BMA10247_2002     CDS       T00479                                 

Definition
bifunctional glucokinase/RpiR family transcriptional regulator
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bmn  Burkholderia mallei NCTC 10247
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:bmn01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bmn00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bmn00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bmn00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bmn00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:bmn00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1970450..1972312
Genome map
AA seq 620 aa AA seqDB search
MADVGGTNARFALETGPGEITQIRVYPGAEYPTLTDAIRKYLKDAKIGRVNHAAIAIANP
VDGDQVRMTNHNWSFSIEATRRALGFDTLLVVNDFTALAMALPGLTDAQRVQIGGGTRRQ
NSVIGLMGPGTGLGVSGLIPADDRWIALGSEGGHATFAPMDEREDLVLQYARRKYPHVSF
ERVCAGPGMEIIYRALAARDKKRIAANVDTADIVERAHAGDALALEAVECFCAILGTFAG
NLAVTLGALGGIYIGGGVVPKLGELFMRSPFRARFEAKGRFEAYLANIPTYLITAEYPAF
LGVSAILAEQLSNRTGGASSAVFERIRQMRDALTPAERRVADLALNHPRSIINDPIVDIA
RKADVSQPTVIRFCRSLGCQGLSDFKLKLATGLTGTIPMSHSQVHLGDTATDFGAKVLDN
TVSAILQLREHLNFEHVEQAIDILNNARRIEFYGLGNSNIVAQDAHYKFFRFGIPTIAYG
DLYMQAASAALLGKGDVIVAVSKSGRAPELLRVLDVAMQAGAKVIAITSSNTPLAKRATV
ALETDHIEMRESQLSMISRILHLVMIDILAVGVAIRRAAPNAELAEAMARAKARAGASAG
DEAADVLDWLSHGAAPAAKD
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
ttggccgacgtcggcggcacgaacgcgcgcttcgcgctcgagacgggcccgggagaaatc
acgcagatccgcgtgtacccgggcgccgagtatccgacgctcaccgacgcgatccgcaag
tatctgaaggacgcgaagatcggccgcgtgaatcacgcggcgatcgcgatcgcgaacccc
gtcgacggcgatcaggtccggatgacgaatcacaactggagcttctcgatcgaggcgacg
cgccgcgcgctcggcttcgatacgctgctcgtcgtcaacgatttcaccgcgctcgcgatg
gcgctgcccggcctgaccgatgcgcagcgcgtacagatcggcggcggcacgcgccgacag
aacagcgtgatcggcctgatggggccgggcacggggctcggcgtgtcggggctcattccc
gccgacgaccgctggatcgcgctcggcagcgaaggcggccacgcgacgttcgcgccgatg
gacgagcgcgaggatctcgtgctgcaatacgcgcgccgcaagtatcctcacgtgtcgttc
gagcgcgtatgcgcgggcccgggcatggagatcatctatcgcgcgctcgccgcgcgcgac
aagaagcgtatcgccgcgaacgtcgacacggccgacatcgtcgagcgcgcgcacgcgggc
gatgcgctcgcgctcgaggcggtcgagtgcttctgcgcgattctcggcacgttcgccggc
aacctcgcggtcacgctcggcgcgttgggcggcatctatatcggcggcggcgtcgtgccg
aagctcggcgagctgttcatgcgctcgccgtttcgcgcgcgcttcgaggcgaagggccgc
ttcgaggcgtatctcgcgaacatcccgacctacctgatcaccgcggaatacccggcgttt
ctcggcgtatcggcgatcctcgccgagcaactgtcgaaccgcacgggcggcgcgtcgtcg
gccgtgttcgagcgcatccgccagatgcgcgacgcgttgacgcccgccgagcggcgcgtc
gccgatctcgcgctcaaccatccgcgctcgatcatcaacgatccgatcgtcgacatcgcg
cgcaaggccgacgtgagccagcccaccgtgatccgcttctgccgctcgctcggctgccag
gggctgtcggacttcaagctgaagctcgcgacgggcctcaccggcacgatcccgatgagc
cacagccaggtgcatctgggcgacaccgcgaccgatttcggcgcgaaggtgctcgacaac
acggtatcggcgatccttcagttgcgcgagcatctgaacttcgagcacgtcgagcaggcg
atcgacatcctgaacaatgcgcggcgcatcgagttctacggcctgggcaattcgaacatc
gtcgcgcaggacgcgcactacaagttcttccgcttcgggattccgacgatcgcgtacggc
gacctgtacatgcaggcggcgtcggccgcgctcctcggcaagggcgacgtgatcgtcgcg
gtgtcgaagtcggggcgcgcgccggagctgttgcgcgtgctcgacgtcgcgatgcaggcg
ggcgcgaaggtgatcgcgatcacgtcgagcaacacgccgctcgccaagcgcgcgacggtc
gcgctcgagaccgatcacatcgagatgcgcgagtcgcagttgtcgatgatctcgcggatc
ctgcatctcgtgatgatcgacatcctcgcggtcggcgtcgcgatccgccgcgccgcgccg
aacgcggagctcgcggaggcgatggcgcgcgcgaaggcgcgcgcgggcgcgagcgcgggc
gacgaggccgccgacgtgctcgactggctgagccacggcgcggcgcccgcggcgaaggac
tga

DBGET integrated database retrieval system