KEGG   Burkholderia mallei NCTC 10247: BMA10247_2006Help
Entry
BMA10247_2006     CDS       T00479                                 

Gene name
dcyD
Definition
D-cysteine desulfhydrase (EC:4.4.1.15)
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
bmn  Burkholderia mallei NCTC 10247
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:bmn00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BMA10247_2006 (dcyD)
Enzymes [BR:bmn01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     BMA10247_2006 (dcyD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1975165..1976184
Genome map
AA seq 339 aa AA seqDB search
MNTTTLSTKLNAFARLNLIDAPTPLQYLPRLSAHVGRDIHVKRDDCTPLAMGGNKLRKLE
FLAADALGQNADVLVTAGAIQSNHVRQTAALVAQLGLGCVALLENPIAAARDDYLQSGNR
LLLDLFDVRAHVVDGLDDVDRQLEAAARRLRDEGRRPYVIPIGGSNPLGALGYVRAGLEL
AQQIRAAERDFAAVVLASGSAGTHAGLAFALAHALPGLPVIGVTVSRTDAQQRPKVRHLL
DGMSGLLDVALPAGARIDLWDDYFAPRYGEPNRAGIDALRLLARTEGLLLDPVYTGKAMA
GLIDGVARGRFDGNGPVLFVHTGGAPALFAYQDACRASR
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaacacgacgacgctctcgacgaaactgaacgccttcgcccgcctgaacctgatcgac
gcgccgacgccgctgcagtacttgccgcgcctgtccgcgcacgtcggccgcgacatccac
gtgaagcgcgacgactgcacgccgctcgcgatgggcggcaacaagctgcgcaagctcgaa
ttcctcgccgcggacgcgctcggccaaaacgcggacgtgctggtgaccgcgggcgcgatc
cagtcgaatcacgtccggcagacggccgcgctcgtcgcgcagctcggcctcggctgtgtc
gcgctgctcgaaaacccgatcgcagccgcgcgcgacgattatctgcaaagcggcaaccgg
ctgctgctcgatctgttcgacgtgcgcgcgcacgtcgtcgacgggctcgacgacgtcgac
cggcaactcgaagccgccgcgcggcggctgcgcgacgaagggcggcgcccgtacgtgatc
ccgatcggcggatcgaatccgctcggcgcgctcggctacgtgcgcgcgggcctcgagctc
gcgcagcagatccgcgcggccgagcgcgatttcgcggctgtcgtgctcgcgtccggcagc
gccggcacgcacgcgggcctcgcgttcgcgctcgcgcacgcgttgcccgggctgccggtg
atcggcgtgacggtatcgcgcaccgacgcgcagcagcgcccgaaggtgcggcatctgctc
gacggcatgagcgggctgctcgacgtcgcgttgccggcgggcgcgcgcatcgatctgtgg
gacgactacttcgcgccgcgctacggcgagcccaatcgcgcgggcatcgacgcgctgcgg
ctgctcgcgcgaaccgaggggctgctgctcgatccggtgtacacgggcaaggcgatggcg
ggtctcatcgacggcgtcgcgcgcggccgcttcgacggaaacggcccggtgctgttcgtg
catacgggcggcgcgcccgcgctgttcgcgtatcaggacgcgtgccgcgcgagccgatga

DBGET integrated database retrieval system