KEGG   Burkholderia mallei NCTC 10247: BMA10247_2064Help
Entry
BMA10247_2064     CDS       T00479                                 

Definition
(GenBank) phosphoglucomutase/phosphomannomutase family protein
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
bmn  Burkholderia mallei NCTC 10247
Pathway
bmn00010  Glycolysis / Gluconeogenesis
bmn00030  Pentose phosphate pathway
bmn00051  Fructose and mannose metabolism
bmn00052  Galactose metabolism
bmn00230  Purine metabolism
bmn00500  Starch and sucrose metabolism
bmn00520  Amino sugar and nucleotide sugar metabolism
bmn00521  Streptomycin biosynthesis
bmn01100  Metabolic pathways
bmn01110  Biosynthesis of secondary metabolites
bmn01120  Microbial metabolism in diverse environments
bmn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bmn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMA10247_2064
   00030 Pentose phosphate pathway
    BMA10247_2064
   00051 Fructose and mannose metabolism
    BMA10247_2064
   00052 Galactose metabolism
    BMA10247_2064
   00500 Starch and sucrose metabolism
    BMA10247_2064
   00520 Amino sugar and nucleotide sugar metabolism
    BMA10247_2064
  Nucleotide metabolism
   00230 Purine metabolism
    BMA10247_2064
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BMA10247_2064
Enzymes [BR:bmn01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     BMA10247_2064
    5.4.2.8  phosphomannomutase
     BMA10247_2064
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: ABO05048
Position
I:complement(2025278..2026672)
Genome map
AA seq 464 aa AA seqDB search
MISQSIFKAYDIRGVIGKTLDADVARSIGRAFGSEVRAQGGDAVVVARDGRLSGPELVGA
LADGLRAAGVDVVDVGMVPTPVGYFAASVPLALSGGERRVDSCIVVTGSHNPPDYNGFKM
VLRGAAIYGDQIQGLYKRIVDARFETGNGSYERYDVADQYVERIVGDIRLARPLKLVVDA
GNGVAGPLATRLFKALGCELVELFTDIDGNFPNHHPDPAHPENLQDVIAKLKTTDAEIGF
AFDGDGDRLGVVTKDGQIIYPDRQLMLFAEEVLSRNPGAQIIYDVKCTRNLAQWVREKGG
EPLMWKTGHSLVKAKLRETGAPLAGEMSGHVFFKDRWYGFDDGLYTGARLLEILARAADP
SALLNGLPNAVSTPELQLKLDEGENVKLIDKLRADAKFDGADEVVTIDGLRVEYPDGFGL
ARSSNTTPVVVLRFEASSDAALVRIQDDFRRALKAAKPDANLPF
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgatctcccaatccatcttcaaggcatacgatattcggggcgtgatcggcaagacgctc
gacgccgacgtcgcacgctcgatcggccgcgcattcggcagcgaagtgcgcgcgcagggc
ggcgacgcggtcgtcgtcgcgcgcgacggccggctctcgggccccgagctcgtcggcgcg
ctcgcggacgggctgcgcgcggcgggcgtcgatgtcgtcgacgtcggcatggtgccgacg
cccgtcggctacttcgcggcgagcgtgccgctcgcgctgtcgggcggcgagcgccgcgtc
gattcgtgcatcgtcgtcacgggcagccacaatccgcccgactacaacggtttcaagatg
gtcctgcgcggcgccgcgatttacggcgaccagatccagggcctgtacaagcgcatcgtc
gacgcgcgtttcgagaccggcaacggttcgtatgagcgatacgatgtcgccgatcaatac
gtcgagcgcatcgtcggcgacatcaggctcgcgcggccgctgaagctcgtcgtcgatgcg
ggcaacggcgtcgcgggcccgctcgcgacgcgcctgttcaaggcgctcggctgcgaactc
gtcgagctcttcaccgacatcgacggcaacttcccgaaccaccacccggacccggcgcac
ccggagaacctgcaggacgtgatcgcgaagctgaagacgaccgatgccgagatcggcttc
gcgttcgacggcgacggcgaccgcctcggcgtcgtcacgaaggacggccagatcatctat
ccggaccgccagctgatgctgttcgccgaggaagtgctgtcgcgcaacccgggcgcgcag
atcatctacgacgtgaagtgcacgcgcaatctcgcgcagtgggtgcgcgagaagggcggc
gagccgctgatgtggaagacgggccactcgctcgtgaaggcgaagctgcgcgagacgggc
gcgccgctcgcgggcgagatgagcggccacgtgttcttcaaggatcgctggtacggcttc
gacgacggcctctacacgggcgcgcgcctgctcgagatcctcgcgcgcgcagccgatccg
agcgcgctgctcaacggcttgccgaacgcggtgtcgacgcccgagctgcaactgaagctc
gacgaaggcgagaacgtgaagctgatcgacaagctgcgcgccgacgcgaagttcgacggc
gcggacgaggtcgtgacgatcgacggtctgcgcgtcgagtatccggacggcttcggtctc
gcgcgttcgtcgaacacgacgcccgtggtcgtgctgcgcttcgaggcgagctccgacgcg
gcgctcgtgcggatccaggacgatttccggcgcgcgctgaaggcggcgaagccggacgcg
aacctgccgttctga

DBGET integrated database retrieval system