KEGG   Burkholderia mallei NCTC 10247: BMA10247_2265Help
Entry
BMA10247_2265     CDS       T00479                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
bmn  Burkholderia mallei NCTC 10247
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bmn00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:bmn00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:bmn02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2234150..2235580
Genome map
AA seq 476 aa AA seqDB search
MRLAALLGASVFAAAGCGSDEPKTPGASDNGAQTGAARNVIFFLGDGMGMTTLTAARIYA
LGEDGALTLDTLPETAFVKTYSNDAQVTDSAPSMSAYMTGVKTNNEVISMTPDTKAIEPS
ASLTGNCGANNGKPVPTLLEIAKAKGLATGVVTTTRVTHATPAATYAHVCHRDAENDIAA
QLVPGGAGYNAALGGGVDVVLGGGAQFFVPKEAGGKRADGRHLVNEPKAKGYAIAQNRDE
LLAADATKRGKLAGLFASSHMSYDLDRGATKEPSLADMATRALDVLQKNPNGYFLMVEGG
RIDHALHDTNAKRALQDTVAFDNAIKATLDKVRQTDPELKNTLVVVTADHDHTLVLNGYA
ARTGKTEAGKPGVLGVLRNYQTGAVAKDADGAPYTIIGFGNGENRVQGSRAGTSLTDAVT
GADDYRQEAVVRMAKGGETHGGTDVFLGAIGRGADGFHGVIENNKVFELVRGAAQL
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
gtgagactggccgcgctccttggcgcgagcgtcttcgcggcggcgggctgcggcagcgac
gagccgaagacgccgggcgcgtcggacaacggcgcgcaaacgggcgccgcgcgcaacgtc
atcttctttctgggcgacggaatggggatgacgacgctcacggccgcgcgaatctatgcg
ctcggcgaggacggcgcgctcacgctcgacacgctgcccgagaccgcgttcgtgaagacc
tattcgaacgatgcgcaggtgacggacagcgcgccgtcgatgtccgcatatatgacgggc
gtgaagacgaacaacgaagtgatctcgatgacgcccgacacgaaggcgatcgagccgagc
gcgagtctcaccggcaactgcggcgcgaacaacggcaagccggtgccgacgctgctcgag
atcgcgaaggcgaaggggctcgccaccggcgtcgtgacgacgacccgcgtcacccacgcg
acgcccgccgcgacctacgcgcacgtgtgccaccgcgacgccgagaacgacatcgccgcg
cagctcgtgccgggcggcgcgggctacaacgcggcgctcggcggcggcgtggatgtcgtg
ctgggcggcggcgcgcaattcttcgtgccgaaggaagcgggcggcaagcgcgcggacggc
cgccatctcgtgaacgagccgaaggcgaagggctacgcgatcgcgcagaaccgcgacgag
ctcctcgccgccgatgcgacgaagcgcggcaagctcgcgggcctgttcgcgtcgagccac
atgagctacgacctcgaccgcggcgcgacgaaagagccgagcctcgccgacatggcgacg
cgcgcgctcgacgtgctgcagaagaacccgaacggctatttcctgatggtcgaaggcggg
cgcatcgatcacgcgctgcacgacacgaacgcgaagcgcgcgctgcaggatacggtcgcg
ttcgacaacgcgatcaaggcgacgctcgacaaggtgcgccagaccgatccggagttgaag
aacacgctcgtcgtcgtgacggccgaccacgatcacacgctggtgctcaacggctacgcg
gcgcgcacgggcaagacggaagcgggcaagccgggcgtgctcggcgtgctgcgcaactat
cagacgggcgcggtcgcgaaggacgcggacggcgcgccgtacacgatcatcggcttcggc
aacggcgagaaccgcgtgcaaggcagccgcgcgggcacgagcctcaccgacgcggtgacg
ggcgcggacgattatcgccaggaagcggtcgtgcgcatggccaagggcggcgagacgcac
ggcggcaccgacgtgttcctcggcgcgatcggccgcggcgcggacggctttcacggcgtg
atcgagaacaacaaggtgttcgagctcgtgcgcggcgcggcgcagctctga

DBGET integrated database retrieval system