KEGG   Burkholderia mallei NCTC 10247: BMA10247_2873Help
Entry
BMA10247_2873     CDS       T00479                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
bmn  Burkholderia mallei NCTC 10247
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bmn00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BMA10247_2873
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BMA10247_2873
Enzymes [BR:bmn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BMA10247_2873
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2822847..2825348
Genome map
AA seq 833 aa AA seqDB search
MNRISHSLCAALLAAATLLPTASRAQLPARPTAGAGAPATAAPVRPASTPAELAARLANG
LAVRVAVDNNHAASAGVPCADLGADWASCATGRLILQNRGHSPLTDGGWKLYLHSIRRLL
RIDRPGFTLRHLTGDLYELTPQPGTVRLAQGERIELPFVAEYWLRRYSDVTPRPYVVVDG
AAPAVLRYDDTDDELRYVETLPADAQNNSPGNAPPAAAQPVANRALPSVKRQRALPGALD
LRGVELTLPELPSAQVAALRERAGTLGLDGARVPVWGVVAPRRLPADIAVPGGYRLAIGP
RGAFIEGADRAGLYYGVQTLFSLVPAGGATVPAMLIEDAPRFTHRGMHVDLARNFKPPAT
LRRLIDQMSAYKLNRLHLHLSDDEGWRIEIPGLPELTDVGARRCHDPSETRCLLPQLGSG
PDDRSGGGYLTRDDYVALLRYAAERFVEVIPEIDMPAHSRAAVVSMEARYRRLHAAGRER
EANAYRLLDAQDTSNLLTVQFYDRRSDLNPCMPGALNFASKVIREIASMHADAQAPLRIW
HFGGDEAKNILLGAGFQPLDGADPGKGRVDLAAQDKPWARSPACTALLRRGEIKSIDELP
TRFAKQVSAIVNANGIGTMAAWQDGIKHASGPREFSTRHVMVSLWDTIFWGASDSARDLS
AKGYRTVLALPDYLYFDFPYTRNPRERGYYWGSQATDEYKVFSLAPENLPQNAEVFGDRD
GNPFEVTSAGAAPSIEGIQGQAWGEVMRNGQLLEYMVYPRLLALAERAWHKADWELPYAA
GVRYKLGDTHHVDTAALERDWAGFATVLKQRELPKLERADIGYRKPTFTLTGE
NT seq 2502 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgaatctcgcattccctgtgcgccgcgctattggccgccgcgacgctgttgccc
acggcctcgcgcgcgcaactgcccgcgcgccccacggccggcgcgggcgcgcccgcgacg
gccgcgcccgtgcggcccgcgtccacgccggccgagctcgccgcgcggctcgccaacggc
ctcgcggtgcgcgtggccgtcgacaacaatcacgcggcatcggccggcgtgccgtgcgcc
gacctcggcgcggactgggcgagctgcgcgacgggccgcctgatcctgcagaatcgcggc
cactcgcccctcaccgacggcggctggaagctctatctgcacagcatccgccggctgctc
cgaatcgaccgccccggcttcacgctgcgccatctgacgggcgatctatacgagctgacg
ccgcagcccggcacggtaaggctcgcgcagggcgagcgcatcgagctgccgttcgtcgcc
gaatactggctgcgccgctacagcgacgtgaccccgcgcccgtacgtggtcgtcgacggc
gcggcgcccgcggtgctgcgctacgacgataccgacgacgagctgcgctacgtcgaaacg
ctgcccgccgacgcgcagaacaactcgcccggcaatgcgccgcccgccgccgcgcagccg
gtggcgaaccgcgcgctgccgagcgtgaagcggcagcgcgcgctgcccggcgcgctcgat
ctgcgcggcgtcgagctgacgctgccggagctgccgtccgcgcaggtcgcggcgctgcgc
gaacgcgcgggcacgctcggcctggacggcgcgcgcgtgccggtgtggggcgtcgtcgcg
ccgcgccggctgcccgccgacatcgcggtgccgggcggctaccggctcgcgatcggcccg
cgcggcgcgttcatcgagggggccgatcgcgcgggcctctactacggcgtgcagacgctc
ttctcgctcgtgccggccggcggcgcgacggtgcccgcgatgctgatcgaagacgcgccg
cgcttcacgcaccgcgggatgcacgtcgatctcgcgcgcaacttcaagccgcccgccacg
ctgcgccggctgatcgaccagatgagcgcgtacaagctcaaccggctgcatctgcacctg
tccgacgacgagggctggcgcatcgagattcccggcctgcccgagctgaccgacgtcggc
gcgcgccgctgccacgacccgagcgagacgcgctgcctgctgccgcagctcggctcgggg
cccgacgatcgttcgggcggcggctacctgacgcgcgacgactacgtcgcgctgctgcgc
tacgcggccgagcgcttcgtcgaagtgatccccgagatcgacatgcccgcgcactcgcgc
gcggccgtcgtatcgatggaggcgcgctatcgccgcctgcacgcggcgggccgcgagcgg
gaagcgaacgcgtatcggctgctcgatgcgcaggacacgtcgaacctgctgaccgtgcag
ttctacgaccggcgcagcgatctgaacccgtgcatgccgggcgcgctgaacttcgcgtcg
aaggtgatccgcgagatcgcgtcgatgcacgcggacgcgcaagcgccgctgcggatctgg
cacttcggcggcgacgaggcgaagaacatcctgctcggcgcgggcttccagccgctcgac
ggcgccgatcccggcaagggccgcgtcgatctcgccgcgcaggacaagccgtgggcgcgc
tcgcccgcctgtacggcgctgcttcggcgcggcgagatcaaatcgatcgacgaattgccg
acgcgcttcgcgaagcaggtcagcgcgatcgtgaacgcgaacggaatcggcacgatggcc
gcgtggcaggacggcatcaagcacgcgagcgggccgcgggagttcagcacgcggcacgtg
atggtgtcgctgtgggacaccatcttctggggcgcgtccgacagcgcgcgcgatctgagc
gcgaagggctaccggaccgtgctcgcgctgcccgattacctgtacttcgatttcccgtac
acgcgcaatccgcgcgagcgcggctattactggggctcgcaggcgacggacgagtacaag
gtgttctcgctcgcgccggagaacctgccgcagaacgccgaggtgttcggcgatcgcgac
ggcaacccgttcgaggtgacgagcgcaggcgcggcgccgagcatcgagggcatccagggg
caggcgtggggcgaggtgatgcgcaacgggcaactgctcgaatacatggtgtatccgcgc
cttctcgcgctcgccgagcgcgcgtggcacaaggccgactgggaactgccctacgcggcc
ggcgtgcgctacaagctcggcgacacgcatcacgtcgacacggccgcgctcgagcgcgac
tgggcgggcttcgcgacggtgctcaagcagcgcgaactgccgaagctcgagcgtgcggac
atcgggtatcgcaagccgacgtttacgctgacgggcgaatga

DBGET integrated database retrieval system