KEGG   Burkholderia mallei NCTC 10247: BMA10247_3058Help
Entry
BMA10247_3058     CDS       T00479                                 

Gene name
gcvP
Definition
(RefSeq) glycine dehydrogenase (EC:1.4.4.2)
  KO
K00281  
glycine dehydrogenase [EC:1.4.4.2]
Organism
bmn  Burkholderia mallei NCTC 10247
Pathway
Glycine, serine and threonine metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bmn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BMA10247_3058 (gcvP)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BMA10247_3058 (gcvP)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BMA10247_3058 (gcvP)
Enzymes [BR:bmn01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.4  With a disulfide as acceptor
    1.4.4.2  glycine dehydrogenase (aminomethyl-transferring)
     BMA10247_3058 (gcvP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(3023916..3026843)
Genome map
AA seq 975 aa AA seqDB search
MKLEHPDRLMNRTPLSLAALETHDAFAERHIGPDAASQQAMLDTLGFATRAALIDAVIPA
SIRRAETLPLGPFAQPKSEAEALAALRALADKNQVFRSYIGQGYYDTHTPAVILRNVLEN
PAWYTAYTPYQPEISQGRLEALLNFQQMVADLTGLEISNASLLDEATAAAEAMTLLQRVG
KPQSNVFYVADDVLPQTLEVIKTRAKPIGIEVKSGPAADAAAANAFGVLLQYPGANGDVR
DYRALADAIHAAGGHVVVAADILALTVLMPPGEWGADVAVGNTQRFGVPMGFGGPHAAYM
AVRDEFKRQMPGRLVGVTVDAQGKPALRLALQTREQHIRREKATSNVCTAQALLAIMASM
YAVYHGPRGLKTIALRVNRIAALLAAGIRHLGYATVNDTFFDTLTIDTGARTAQLHAFAQ
AKRINLRRAGDTRVGVSVDETTTRADLADLLTIFAQAAGATAPDIDALDAGLLPAPALPP
SLERTSAYLTHHVFNRHHSETEMLRYLRSLSDKDLALDRSMIPLGSCTMKLNATSEMLPV
TWPEFGRIHPFAPAEQTVGYREMIDQLEQMLVAATGYAAVSLQPNAGSQGEYAGLLIIHA
YHESRGESHRDVCLIPASAHGTNPASAHMAGMKVVVVACDAQGNVDIADLKAKADAHSHD
LAAIMITYPSTHGVFEQNVREICEIVHAHGGQVYVDGANMNAMVGLTAPGQFGGDVSHLN
LHKTFCIPHGGGGPGVGPVAVGPHLAKFLPNQRSTGYARGEDGIGAVSAAPYGSASILPI
SWMYIAMMGAKNLTAATETAILNANYIAKRLAPHYPVLYSGPGGLVAHECILDLRPIKDS
SGITVDDVAKRLMDYGFHAPTMSFPVPGTLMVEPTESESQEELDRFIAAMIAIRDEIRAV
EEGRADREDNPLRHAPHTAAVVTANEWPHAYSREQAAFPVASLVANKYWPPVGRADNAYG
DRNLFCSCVPVSDYA
NT seq 2928 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcgaacacccggaccgcctgatgaaccgcacgcccctctcgctcgccgcgctc
gaaacgcacgacgcgttcgccgaacgccatatcggccccgacgccgccagccagcaggcc
atgctcgacacgctcggcttcgcgacgcgcgccgcactgatcgacgccgtgatccccgcg
tcgatccgccgcgccgaaacgctgccgctcggcccgttcgcgcagccgaagagcgaagcc
gaagcgctcgccgcgctgcgcgcgctcgcggacaagaaccaggtgttccgctcgtacatc
ggccaaggctactacgacacccacaccccggcggtgatcctgcgcaacgtgctcgaaaac
ccggcgtggtacaccgcgtacacgccgtaccaacccgaaatctcgcagggccgcctcgag
gcgctgctgaacttccagcagatggtcgccgacctgacgggcctcgagatctccaacgcg
tcgctgctcgacgaagccacggccgcagccgaagcgatgacgctgctgcaacgcgtcggc
aagccgcagtcgaacgtgttctacgtcgccgacgacgtgctgccgcaaacgctcgaagtg
atcaagacgcgcgcgaagccgatcggcatcgaagtgaagtcgggcccggccgccgacgcc
gccgccgcgaacgcgttcggcgtgctgctgcaatatccgggcgcgaacggcgacgtgcgc
gactaccgcgcgctcgccgacgcgatccacgccgcgggcggccacgtcgtcgtcgcggcc
gacatcctcgcgctcaccgtgctcatgccgcccggcgaatggggcgcggacgtcgccgtc
ggcaacacgcagcgcttcggcgtgccgatgggcttcggcggcccgcacgccgcatacatg
gcggtgcgcgacgaattcaagcggcagatgccgggccgcctcgtcggcgtgaccgtcgac
gcgcagggcaagcccgcgctgcgcctcgcgctgcaaacgcgcgagcaacacatccgccgc
gagaaggcaacgtcgaacgtctgcaccgcgcaggcgctgctcgcgatcatggcgagcatg
tacgcggtctaccacggcccgcgcggcctgaagacgatcgcgctgcgcgtgaaccgcatc
gcggcgctcctcgccgcgggcatcaggcatctcggctacgcaaccgtcaacgacacgttc
ttcgacacgctgacgatcgacaccggcgcgcgcaccgcgcaactccatgcgttcgcgcaa
gcgaagcgcatcaacctgcgccgcgcgggcgacacgcgagtcggcgtgtcggtcgacgaa
acgacgacgcgcgccgatctcgccgatctgctcacgatcttcgcgcaggccgcgggcgcg
acggcgcccgacatcgacgcgctcgacgccgggctcctccccgcgcccgcgctgccgccg
agcctcgagcgcacgagcgcgtacctgacgcaccacgtgttcaaccgccaccattcggaa
acggaaatgctgcgctacctgcgcagcctgtcggacaaggatctcgcgctcgaccgctcg
atgatcccgctcggctcgtgcacgatgaagctgaacgcgacctccgaaatgctgcccgtc
acgtggcccgaattcggccggatccacccgttcgcgcccgccgagcagaccgtcggctat
cgcgagatgatcgaccagctcgagcagatgctcgtcgcggcaacgggctacgcggccgtg
tcgctgcagccgaacgccggctcgcagggcgagtacgcgggcctgctcatcatccatgcg
tatcacgaatcgcgcggcgaaagccaccgcgatgtctgcctgattccggcgtccgcgcac
ggcacgaacccggcgtcggcgcacatggccggcatgaaggtcgtggtggtcgcgtgcgac
gcgcaaggcaacgtcgacatcgccgacctgaaggcgaaggccgacgcgcattcgcacgac
ctcgcggcgatcatgatcacgtatccgtcgacgcacggcgtgttcgagcagaacgtgcgc
gagatctgcgagatcgtccacgcgcacggcggccaggtgtacgtcgacggcgcgaacatg
aacgcgatggtcggcctcaccgcgcccggccagttcggcggcgacgtgtcgcacttgaac
ctgcacaagaccttctgcatcccgcacggcggcggcggcccgggcgtcggcccggtcgcg
gtcggcccgcacctcgcgaaattcctgccgaaccagcgctcgacgggctacgcgcgcggc
gaagacggcatcggcgcggtgtcggcggcgccttacggctcggcgtcgatcctgccgatc
tcgtggatgtacatcgcgatgatgggcgcgaagaatttgaccgcggcgaccgaaaccgcg
atcctcaacgcgaactacatcgcgaagcgcctcgcgccgcactatccggtgctgtattcg
ggcccgggcgggctcgtcgcgcacgaatgcattctcgatctgcgcccgatcaaggattcg
agcggcatcaccgtcgacgacgtcgccaagcgcctgatggactacggctttcacgcaccg
acgatgagcttcccggtgccgggcacgctgatggtcgagccgaccgaatcggaatcgcag
gaggaactggaccgcttcatcgcggcgatgatcgcgatccgcgacgaaatccgcgcagtc
gaggaaggccgcgccgaccgcgaggacaacccgctgcgtcacgcgccgcacacggcagcc
gtcgtcaccgcgaacgaatggccgcacgcgtactcgcgcgagcaggccgcgttcccggtc
gcgtcgctcgtcgcgaacaagtactggccgcccgtcggccgcgcggacaacgcatatggc
gaccgcaatctgttctgctcctgcgtgccggtatcggattacgcctga

DBGET integrated database retrieval system