KEGG   Burkholderia mallei NCTC 10247: BMA10247_3058Help
Entry
BMA10247_3058     CDS       T00479                                 

Gene name
gcvP
Definition
glycine dehydrogenase (EC:1.4.4.2)
Orthology
K00281  
glycine dehydrogenase [EC:1.4.4.2]
Organism
bmn  Burkholderia mallei NCTC 10247
Pathway
Glycine, serine and threonine metabolism
Metabolic pathways
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bmn01200]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:bmn00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(3023916..3026843)
Genome map
AA seq 975 aa AA seqDB search
MKLEHPDRLMNRTPLSLAALETHDAFAERHIGPDAASQQAMLDTLGFATRAALIDAVIPA
SIRRAETLPLGPFAQPKSEAEALAALRALADKNQVFRSYIGQGYYDTHTPAVILRNVLEN
PAWYTAYTPYQPEISQGRLEALLNFQQMVADLTGLEISNASLLDEATAAAEAMTLLQRVG
KPQSNVFYVADDVLPQTLEVIKTRAKPIGIEVKSGPAADAAAANAFGVLLQYPGANGDVR
DYRALADAIHAAGGHVVVAADILALTVLMPPGEWGADVAVGNTQRFGVPMGFGGPHAAYM
AVRDEFKRQMPGRLVGVTVDAQGKPALRLALQTREQHIRREKATSNVCTAQALLAIMASM
YAVYHGPRGLKTIALRVNRIAALLAAGIRHLGYATVNDTFFDTLTIDTGARTAQLHAFAQ
AKRINLRRAGDTRVGVSVDETTTRADLADLLTIFAQAAGATAPDIDALDAGLLPAPALPP
SLERTSAYLTHHVFNRHHSETEMLRYLRSLSDKDLALDRSMIPLGSCTMKLNATSEMLPV
TWPEFGRIHPFAPAEQTVGYREMIDQLEQMLVAATGYAAVSLQPNAGSQGEYAGLLIIHA
YHESRGESHRDVCLIPASAHGTNPASAHMAGMKVVVVACDAQGNVDIADLKAKADAHSHD
LAAIMITYPSTHGVFEQNVREICEIVHAHGGQVYVDGANMNAMVGLTAPGQFGGDVSHLN
LHKTFCIPHGGGGPGVGPVAVGPHLAKFLPNQRSTGYARGEDGIGAVSAAPYGSASILPI
SWMYIAMMGAKNLTAATETAILNANYIAKRLAPHYPVLYSGPGGLVAHECILDLRPIKDS
SGITVDDVAKRLMDYGFHAPTMSFPVPGTLMVEPTESESQEELDRFIAAMIAIRDEIRAV
EEGRADREDNPLRHAPHTAAVVTANEWPHAYSREQAAFPVASLVANKYWPPVGRADNAYG
DRNLFCSCVPVSDYA
NT seq 2928 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcgaacacccggaccgcctgatgaaccgcacgcccctctcgctcgccgcgctc
gaaacgcacgacgcgttcgccgaacgccatatcggccccgacgccgccagccagcaggcc
atgctcgacacgctcggcttcgcgacgcgcgccgcactgatcgacgccgtgatccccgcg
tcgatccgccgcgccgaaacgctgccgctcggcccgttcgcgcagccgaagagcgaagcc
gaagcgctcgccgcgctgcgcgcgctcgcggacaagaaccaggtgttccgctcgtacatc
ggccaaggctactacgacacccacaccccggcggtgatcctgcgcaacgtgctcgaaaac
ccggcgtggtacaccgcgtacacgccgtaccaacccgaaatctcgcagggccgcctcgag
gcgctgctgaacttccagcagatggtcgccgacctgacgggcctcgagatctccaacgcg
tcgctgctcgacgaagccacggccgcagccgaagcgatgacgctgctgcaacgcgtcggc
aagccgcagtcgaacgtgttctacgtcgccgacgacgtgctgccgcaaacgctcgaagtg
atcaagacgcgcgcgaagccgatcggcatcgaagtgaagtcgggcccggccgccgacgcc
gccgccgcgaacgcgttcggcgtgctgctgcaatatccgggcgcgaacggcgacgtgcgc
gactaccgcgcgctcgccgacgcgatccacgccgcgggcggccacgtcgtcgtcgcggcc
gacatcctcgcgctcaccgtgctcatgccgcccggcgaatggggcgcggacgtcgccgtc
ggcaacacgcagcgcttcggcgtgccgatgggcttcggcggcccgcacgccgcatacatg
gcggtgcgcgacgaattcaagcggcagatgccgggccgcctcgtcggcgtgaccgtcgac
gcgcagggcaagcccgcgctgcgcctcgcgctgcaaacgcgcgagcaacacatccgccgc
gagaaggcaacgtcgaacgtctgcaccgcgcaggcgctgctcgcgatcatggcgagcatg
tacgcggtctaccacggcccgcgcggcctgaagacgatcgcgctgcgcgtgaaccgcatc
gcggcgctcctcgccgcgggcatcaggcatctcggctacgcaaccgtcaacgacacgttc
ttcgacacgctgacgatcgacaccggcgcgcgcaccgcgcaactccatgcgttcgcgcaa
gcgaagcgcatcaacctgcgccgcgcgggcgacacgcgagtcggcgtgtcggtcgacgaa
acgacgacgcgcgccgatctcgccgatctgctcacgatcttcgcgcaggccgcgggcgcg
acggcgcccgacatcgacgcgctcgacgccgggctcctccccgcgcccgcgctgccgccg
agcctcgagcgcacgagcgcgtacctgacgcaccacgtgttcaaccgccaccattcggaa
acggaaatgctgcgctacctgcgcagcctgtcggacaaggatctcgcgctcgaccgctcg
atgatcccgctcggctcgtgcacgatgaagctgaacgcgacctccgaaatgctgcccgtc
acgtggcccgaattcggccggatccacccgttcgcgcccgccgagcagaccgtcggctat
cgcgagatgatcgaccagctcgagcagatgctcgtcgcggcaacgggctacgcggccgtg
tcgctgcagccgaacgccggctcgcagggcgagtacgcgggcctgctcatcatccatgcg
tatcacgaatcgcgcggcgaaagccaccgcgatgtctgcctgattccggcgtccgcgcac
ggcacgaacccggcgtcggcgcacatggccggcatgaaggtcgtggtggtcgcgtgcgac
gcgcaaggcaacgtcgacatcgccgacctgaaggcgaaggccgacgcgcattcgcacgac
ctcgcggcgatcatgatcacgtatccgtcgacgcacggcgtgttcgagcagaacgtgcgc
gagatctgcgagatcgtccacgcgcacggcggccaggtgtacgtcgacggcgcgaacatg
aacgcgatggtcggcctcaccgcgcccggccagttcggcggcgacgtgtcgcacttgaac
ctgcacaagaccttctgcatcccgcacggcggcggcggcccgggcgtcggcccggtcgcg
gtcggcccgcacctcgcgaaattcctgccgaaccagcgctcgacgggctacgcgcgcggc
gaagacggcatcggcgcggtgtcggcggcgccttacggctcggcgtcgatcctgccgatc
tcgtggatgtacatcgcgatgatgggcgcgaagaatttgaccgcggcgaccgaaaccgcg
atcctcaacgcgaactacatcgcgaagcgcctcgcgccgcactatccggtgctgtattcg
ggcccgggcgggctcgtcgcgcacgaatgcattctcgatctgcgcccgatcaaggattcg
agcggcatcaccgtcgacgacgtcgccaagcgcctgatggactacggctttcacgcaccg
acgatgagcttcccggtgccgggcacgctgatggtcgagccgaccgaatcggaatcgcag
gaggaactggaccgcttcatcgcggcgatgatcgcgatccgcgacgaaatccgcgcagtc
gaggaaggccgcgccgaccgcgaggacaacccgctgcgtcacgcgccgcacacggcagcc
gtcgtcaccgcgaacgaatggccgcacgcgtactcgcgcgagcaggccgcgttcccggtc
gcgtcgctcgtcgcgaacaagtactggccgcccgtcggccgcgcggacaacgcatatggc
gaccgcaatctgttctgctcctgcgtgccggtatcggattacgcctga

DBGET integrated database retrieval system