KEGG   Burkholderia mallei NCTC 10247: BMA10247_3191Help
Entry
BMA10247_3191     CDS       T00479                                 

Definition
D-amino acid aminotransferase (EC:2.6.1.-)
Orthology
K00824  
D-alanine transaminase [EC:2.6.1.21]
Organism
bmn  Burkholderia mallei NCTC 10247
Pathway
Lysine degradation
Arginine and proline metabolism
Phenylalanine metabolism
D-Arginine and D-ornithine metabolism
D-Alanine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmn00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    BMA10247_3191
   00330 Arginine and proline metabolism
    BMA10247_3191
   00360 Phenylalanine metabolism
    BMA10247_3191
  Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    BMA10247_3191
   00473 D-Alanine metabolism
    BMA10247_3191
Enzymes [BR:bmn01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.21  D-amino-acid transaminase
     BMA10247_3191
Amino acid related enzymes [BR:bmn01007]
 Aminotransferase (transaminase)
  Class IV
   BMA10247_3191
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(3154667..3155614)
Genome map
AA seq 315 aa AA seqDB search
MNQADIEPIVYLSVASHEELVPLSEARVPVLDRGFIFGDGVYEVVPVYADGARRAPFRIA
QHLARLARSLKRIGIADPHDEAGWRALVAQVVDANAAALGDGRHAIVYIQVTRGVAKRGH
AFPANAVPTVFAMASPLALPSDAQRAQGVRCVTAEDRRWLHCDIKSVSLLGNVLMAQHAA
EHDAIETIQLRDGNVTEGSSSNVWIVKNGELIAPPRSNRILEGIRYALVEELAEECGIRF
VAREINEAELRAADEILLTSATKEVLPVTRLDDLPVQGGRPGPVFDALYAAYQRAKAREM
EASERAVPPTRGETT
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaagccgacatcgaaccgatcgtctatctgagcgtcgcttcgcacgaggagctg
gtgccgctttccgaagcgcgcgtgccggtgctcgaccgcggcttcatcttcggcgacggc
gtatacgaagtcgtgccggtctacgcggacggcgcgcgccgcgcgccgttccggatcgcg
cagcatctcgcgcgcctcgcgcgcagcctgaagaggatcggcatcgccgatccgcacgac
gaagcgggctggcgcgcgctcgtcgcgcaggtcgtcgacgcgaacgcggccgcgctcggc
gacggccggcacgcgatcgtctatatccaggtgacgcgcggcgtcgcgaagcgcggccac
gcgttcccggcgaacgctgtgccgacggtgttcgcgatggcgagcccgctcgcgctgccg
agcgacgcgcagcgcgcgcagggcgtgcgctgcgtgacggccgaggatcgccgctggctg
cattgcgacatcaaatcggtatcgctgctcggcaacgtgctgatggcgcagcacgcggcg
gagcacgatgcgatcgagacgatccagctgcgcgacggcaacgtgacggaaggttcgtcg
tcgaatgtatggatcgtgaagaacggcgagctgatcgcgccgccgcgcagcaaccggatt
ctcgagggcatccgctacgcgctcgtcgaggagctcgccgaggaatgcgggattcgcttc
gtcgcgcgcgagatcaacgaagcggagctgcgcgcggccgacgagatcctgctcacgtcg
gcgacgaaggaagtcctgcccgtgacgcggctcgacgatctgcccgtgcagggcggccgg
ccgggcccggtgttcgacgcgctgtacgccgcgtaccagcgcgcgaaggcgcgcgagatg
gaagcgtctgagcgggccgtgccgccgacgcgtggagaaacgacatga

DBGET integrated database retrieval system