KEGG   Burkholderia mallei NCTC 10247: BMA10247_3191Help
Entry
BMA10247_3191     CDS       T00479                                 

Definition
D-amino acid aminotransferase (EC:2.6.1.-)
Orthology
K00824  
D-alanine transaminase [EC:2.6.1.21]
Organism
bmn  Burkholderia mallei NCTC 10247
Pathway
Lysine degradation
Arginine and proline metabolism
Phenylalanine metabolism
D-Arginine and D-ornithine metabolism
D-Alanine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:bmn00310]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bmn00330]
Metabolism; Amino acid metabolism; Phenylalanine metabolism [PATH:bmn00360]
Metabolism; Metabolism of other amino acids; D-Arginine and D-ornithine metabolism [PATH:bmn00472]
Metabolism; Metabolism of other amino acids; D-Alanine metabolism [PATH:bmn00473]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(3154667..3155614)
Genome map
AA seq 315 aa AA seqDB search
MNQADIEPIVYLSVASHEELVPLSEARVPVLDRGFIFGDGVYEVVPVYADGARRAPFRIA
QHLARLARSLKRIGIADPHDEAGWRALVAQVVDANAAALGDGRHAIVYIQVTRGVAKRGH
AFPANAVPTVFAMASPLALPSDAQRAQGVRCVTAEDRRWLHCDIKSVSLLGNVLMAQHAA
EHDAIETIQLRDGNVTEGSSSNVWIVKNGELIAPPRSNRILEGIRYALVEELAEECGIRF
VAREINEAELRAADEILLTSATKEVLPVTRLDDLPVQGGRPGPVFDALYAAYQRAKAREM
EASERAVPPTRGETT
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaagccgacatcgaaccgatcgtctatctgagcgtcgcttcgcacgaggagctg
gtgccgctttccgaagcgcgcgtgccggtgctcgaccgcggcttcatcttcggcgacggc
gtatacgaagtcgtgccggtctacgcggacggcgcgcgccgcgcgccgttccggatcgcg
cagcatctcgcgcgcctcgcgcgcagcctgaagaggatcggcatcgccgatccgcacgac
gaagcgggctggcgcgcgctcgtcgcgcaggtcgtcgacgcgaacgcggccgcgctcggc
gacggccggcacgcgatcgtctatatccaggtgacgcgcggcgtcgcgaagcgcggccac
gcgttcccggcgaacgctgtgccgacggtgttcgcgatggcgagcccgctcgcgctgccg
agcgacgcgcagcgcgcgcagggcgtgcgctgcgtgacggccgaggatcgccgctggctg
cattgcgacatcaaatcggtatcgctgctcggcaacgtgctgatggcgcagcacgcggcg
gagcacgatgcgatcgagacgatccagctgcgcgacggcaacgtgacggaaggttcgtcg
tcgaatgtatggatcgtgaagaacggcgagctgatcgcgccgccgcgcagcaaccggatt
ctcgagggcatccgctacgcgctcgtcgaggagctcgccgaggaatgcgggattcgcttc
gtcgcgcgcgagatcaacgaagcggagctgcgcgcggccgacgagatcctgctcacgtcg
gcgacgaaggaagtcctgcccgtgacgcggctcgacgatctgcccgtgcagggcggccgg
ccgggcccggtgttcgacgcgctgtacgccgcgtaccagcgcgcgaaggcgcgcgagatg
gaagcgtctgagcgggccgtgccgccgacgcgtggagaaacgacatga

DBGET integrated database retrieval system