KEGG   Burkholderia mallei NCTC 10247: BMA10247_3310Help
Entry
BMA10247_3310     CDS       T00479                                 

Definition
guanyl-specific ribonuclease Sa (EC:3.1.27.3)
Orthology
K01167  
ribonuclease T1 [EC:3.1.27.3]
Organism
bmn  Burkholderia mallei NCTC 10247
Brite
Enzymes [BR:bmn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.3  ribonuclease T1
     BMA10247_3310
Transfer RNA biogenesis [BR:bmn03016]
 Eukaryotic Type
  3'processing and CCA adding factors
   3'processing factor
    BMA10247_3310
 Prokaryotic Type
    BMA10247_3310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:3276956..3277387
Genome map
AA seq 143 aa AA seqDB search
MARKWLRNGALASVFAIVAMGNIGATPGSLVSAAYAREAATVDGAAAQVDTIPASRLPRE
AATTLSLIAAGGPYPYGKDGAVFGNYERILPKMRRGYYHEYTVPTPRARNRGARRIVCGG
PLRRVDNCYYTGDHYNSFKRIVD
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcaagtggctccgcaacggcgcgctcgcgtccgtcttcgcgatcgtcgcgatg
ggcaacatcggcgctacgccgggcagtctggtttccgccgcatacgcacgggaagccgcc
acggtcgacggggcggcggcgcaggtcgatacgatccccgcatcccgtttgccgcgcgag
gcagcaaccacgctcagcctgatcgccgcgggcggtccctatccgtacgggaaagacggc
gcggtattcggcaattacgaacggatcttgccgaagatgcggcgcggctattaccacgag
tacacggtgccgacgccgcgcgcccgcaatcgcggcgcgcggcgcatcgtctgcggcggc
cccttgaggcgcgtcgacaattgttattacaccggcgaccactacaacagtttcaaacgt
atcgttgattga

DBGET integrated database retrieval system