KEGG   Burkholderia mallei NCTC 10247: BMA10247_A0142Help
Entry
BMA10247_A0142    CDS       T00479                                 

Gene name
pfk
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
bmn  Burkholderia mallei NCTC 10247
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bmn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BMA10247_A0142 (pfk)
   01230 Biosynthesis of amino acids
    BMA10247_A0142 (pfk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMA10247_A0142 (pfk)
   00030 Pentose phosphate pathway
    BMA10247_A0142 (pfk)
   00051 Fructose and mannose metabolism
    BMA10247_A0142 (pfk)
   00052 Galactose metabolism
    BMA10247_A0142 (pfk)
  Energy metabolism
   00680 Methane metabolism
    BMA10247_A0142 (pfk)
Enzymes [BR:bmn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BMA10247_A0142 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:114905..116254
Genome map
AA seq 449 aa AA seqDB search
MRGACASRAMFDTGGKRQAASGKRQAASGKRQAASGKRQAASGKRQAASGKRQAASGKRQ
AASSKQQAASSKQQAASSKQQAASSSRPAPVLMVRRRIERKHCGACPPRSTREPRTRASR
CVVFPSRIPTLKPNVTMPEIVTLTPNPAIDVATCVERVTDTRKLRCGPARRDPGGGGINV
ARVLTRLGADCSAVYLAGGGTGLALRGLLADEGVRAHGIDIAGETRENFSVLETSTGREF
RFVLPGPALAAHEWPRCVEALGRLADASRYLVMSGSLPPGMPDDCYARLARRASARGVRT
VVDTSGPALAAALDAGVYLVKPSLGELRALTGLPLEDDGARLAAARAIVAGGRAQIVALT
LGDAGALVVSRDDAVRLPGVKVAVRSAIGAGDSFVAGLVAALNRGANVADAARHALAAAS
ASLLSTGTALGTKEDIARIYRELPGTIDA
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcggcgcttgcgcgtcgcgcgcgatgttcgatactggcggcaagcggcaagcggca
agcggcaagcggcaagcggcaagcggcaagcggcaagcggcaagcggcaagcggcaagcg
gcaagcggcaagcggcaagcggcaagcggcaagcggcaagcggcaagcggcaagcggcaa
gcggcaagcagcaagcagcaagcagcaagcagcaagcagcaagcagcaagcagcaagcag
caagcagcaagcagcagtcgacctgcgccggtgctgatggttcgacgccgaatcgaacgc
aagcattgcggcgcgtgcccgccgcgcagcacccgcgagccgcgcacccgagccagccgc
tgcgttgtctttccgtcgcgaattcccacgttgaaaccgaacgtcacgatgcccgaaatc
gtcaccctcacgccgaatcccgccatcgacgtcgcgacgtgcgtcgagcgagtcaccgac
acccgcaagctgcgctgcggccccgcacgacgcgatccgggcggcggcggaatcaatgtc
gcccgcgtgctgacgcgcctcggcgccgattgttcggccgtctacctggcgggcggcggc
accggcctcgcgctgcgcggcctgctcgccgacgaaggcgtgcgggcgcatggcatcgac
atcgccggcgagacgcgcgaaaacttttcggtgctcgaaacgtcgacgggccgcgaattc
cgcttcgtgttgcccgggccggcgctcgcggcgcacgaatggccgcgctgcgtcgaagcg
ctcgggcggctcgccgacgcgtcgcgctatctggtgatgagcggcagcctgccgcccggc
atgccggacgattgctacgcccggctcgcgcggcgcgcgagcgcgcgcggcgtgcgcacg
gtcgtcgatacgtcgggaccggcgctcgccgccgcgctcgatgcgggcgtctatctggtg
aagccgagcctcggcgagttgcgcgcgctgaccggcctgccgctcgaagacgacggcgcg
cgccttgccgccgcgcgcgcgatcgtcgccggcgggcgcgcgcagatcgtcgcgctgacg
ctcggcgacgcgggcgcgctcgtcgtgtcgcgcgacgatgcggtgcgtctgccgggcgtg
aaggtggcggtgcgcagcgcgatcggcgcgggcgacagcttcgtcgcggggctcgtcgcc
gcgctcaatcgcggcgcgaacgtcgccgacgcggcgcgccatgcgctcgccgccgcgtcg
gcgtcgctgctgagcacgggcaccgcgctgggcacgaaggaagacatcgcgcggatctat
cgcgaactgccggggacgatcgacgcgtga

DBGET integrated database retrieval system