KEGG   Burkholderia mallei NCTC 10247: BMA10247_A0189Help
Entry
BMA10247_A0189    CDS       T00479                                 

Definition
zinc-containing alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bmn  Burkholderia mallei NCTC 10247
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:bmn01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bmn00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:bmn00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:bmn00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:bmn00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:bmn00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:160844..161830
Genome map
AA seq 328 aa AA seqDB search
MRAMVFDGGAPRLREAELPDPVPAAGQLLIDVHACGVCRTDLHVVDGDLRDPKRPVIPGH
EIVGTVAALGALAKGFTIGERVGVPWLGRTCGHCAYCASGRENLCDAPGFTGYTIDGGYA
QRTVADARFCVHVPSRYDDIHAAPLLCAGLIGYRTLKMAGSARRIGLYGFGAAAHLVAQV
ARFQGRTVYAFTRPGDAAAQRLARRLGAAWAGGSDEAAPEPLDAALIFASVGALVPAALA
AVVKGGAVVCGGIHMSDIPSFSYDLLWGERRIVSVANLTRDDAAEFMRIANDVPLDVEAT
PYPLAQANQALDDLRAGRLAGAAVLTMR
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcgatggtattcgacggcggcgcgccgcggctgcgcgaagccgagctgccggac
cccgtgccggcggcggggcaactgctgatcgacgtgcacgcgtgcggcgtgtgccggacc
gatctgcacgtcgtcgacggcgatctgcgcgatccgaagcggccggtgattccggggcac
gagatcgtcggcacggtggccgcgctcggcgcgctcgcgaagggtttcacgatcggcgag
cgtgtcggcgtgccttggctcgggcgcacgtgcggccattgcgcgtactgcgcgagcggc
cgcgagaacctgtgcgatgcgcccggcttcaccggctacacgatcgacggcggctatgcg
cagcgcacggtcgccgacgcgcgcttttgcgtgcacgtgccgagccgctacgacgatatt
catgcggcgccgctgctgtgcgcgggtctcatcggctaccggacgctgaagatggccggt
tccgcgcggcgcatcggcctgtacggattcggcgcggccgcgcacctcgtcgcgcaggtc
gcgcgttttcaggggcgcaccgtttatgcgttcacgcgcccgggcgacgccgccgcacag
cggctcgcgcgccggctcggcgccgcgtgggcgggcggcagcgacgaagccgcgcccgag
ccgctcgatgcggcgctgatcttcgcatcggtcggcgcgctcgtgccggccgcgctcgcg
gcggtcgtgaagggcggcgccgtcgtgtgcggtgggattcacatgtcggacattccgtcg
ttttcgtacgatttgttgtggggcgagcggcggatcgtatcggtcgcgaacctgacgcgc
gacgacgcggccgaattcatgcggattgcgaacgacgtgccgctcgacgtggaggcaacg
ccgtatccgctcgcgcaggcgaaccaggcactcgacgatctgcgcgccggacgtctggcc
ggggcggcggtgttgacgatgcgctag

DBGET integrated database retrieval system