KEGG   Burkholderia mallei NCTC 10247: BMA10247_A0189Help
Entry
BMA10247_A0189    CDS       T00479                                 

Definition
zinc-containing alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bmn  Burkholderia mallei NCTC 10247
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bmn00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BMA10247_A0189
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMA10247_A0189
  Lipid metabolism
   00071 Fatty acid degradation
    BMA10247_A0189
  Amino acid metabolism
   00350 Tyrosine metabolism
    BMA10247_A0189
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BMA10247_A0189
   00626 Naphthalene degradation
    BMA10247_A0189
Enzymes [BR:bmn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BMA10247_A0189
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:160844..161830
Genome map
AA seq 328 aa AA seqDB search
MRAMVFDGGAPRLREAELPDPVPAAGQLLIDVHACGVCRTDLHVVDGDLRDPKRPVIPGH
EIVGTVAALGALAKGFTIGERVGVPWLGRTCGHCAYCASGRENLCDAPGFTGYTIDGGYA
QRTVADARFCVHVPSRYDDIHAAPLLCAGLIGYRTLKMAGSARRIGLYGFGAAAHLVAQV
ARFQGRTVYAFTRPGDAAAQRLARRLGAAWAGGSDEAAPEPLDAALIFASVGALVPAALA
AVVKGGAVVCGGIHMSDIPSFSYDLLWGERRIVSVANLTRDDAAEFMRIANDVPLDVEAT
PYPLAQANQALDDLRAGRLAGAAVLTMR
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcgatggtattcgacggcggcgcgccgcggctgcgcgaagccgagctgccggac
cccgtgccggcggcggggcaactgctgatcgacgtgcacgcgtgcggcgtgtgccggacc
gatctgcacgtcgtcgacggcgatctgcgcgatccgaagcggccggtgattccggggcac
gagatcgtcggcacggtggccgcgctcggcgcgctcgcgaagggtttcacgatcggcgag
cgtgtcggcgtgccttggctcgggcgcacgtgcggccattgcgcgtactgcgcgagcggc
cgcgagaacctgtgcgatgcgcccggcttcaccggctacacgatcgacggcggctatgcg
cagcgcacggtcgccgacgcgcgcttttgcgtgcacgtgccgagccgctacgacgatatt
catgcggcgccgctgctgtgcgcgggtctcatcggctaccggacgctgaagatggccggt
tccgcgcggcgcatcggcctgtacggattcggcgcggccgcgcacctcgtcgcgcaggtc
gcgcgttttcaggggcgcaccgtttatgcgttcacgcgcccgggcgacgccgccgcacag
cggctcgcgcgccggctcggcgccgcgtgggcgggcggcagcgacgaagccgcgcccgag
ccgctcgatgcggcgctgatcttcgcatcggtcggcgcgctcgtgccggccgcgctcgcg
gcggtcgtgaagggcggcgccgtcgtgtgcggtgggattcacatgtcggacattccgtcg
ttttcgtacgatttgttgtggggcgagcggcggatcgtatcggtcgcgaacctgacgcgc
gacgacgcggccgaattcatgcggattgcgaacgacgtgccgctcgacgtggaggcaacg
ccgtatccgctcgcgcaggcgaaccaggcactcgacgatctgcgcgccggacgtctggcc
ggggcggcggtgttgacgatgcgctag

DBGET integrated database retrieval system