KEGG   Burkholderia mallei NCTC 10247: BMA10247_A0259Help
Entry
BMA10247_A0259    CDS       T00479                                 

Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K13491  
two-component system, chemotaxis family, response regulator WspF [EC:3.1.1.61]
Organism
bmn  Burkholderia mallei NCTC 10247
Pathway
Two-component system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:bmn02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:222830..223858
Genome map
AA seq 342 aa AA seqDB search
MNIGIVNDLPLAVEALRRTIALRPEHRVLWVATDGAQALDFCVAQPPDLVLMDLVMPRID
GVSATRSIMERSPCAILIVTANVGANASYVYEAMGAGALDAVDTPTLEQGGSADPSQPLL
AKIDQIGRLLATRMPLAAPAAAAPAPQGALPPLVAIGASAGGPTALTALLRRLPDDFPAA
LVIVQHVDQAFAIGMAQWLDGYSPLPVRIARQGSVPQAGEVLLAATNDHLHLTSRGVLAY
TRRPEETPYRPSVDVFFHSVVDHWKGEAIGVLLTGMGRDGALGLKAMRTKGHYTIAQDEA
TSAVYGMPKAAAAIGAASAVLPLERIADQLISLVQRNRQRWR
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcggcatcgtcaacgacttgccgctcgccgtcgaggcgctgcgccgcacgatc
gcactgcggcccgagcaccgcgtgctgtgggtcgcgacggacggcgcgcaggcgctcgac
ttctgcgtcgcgcagccgccggacctcgtcctgatggatctcgtgatgccgcgcatcgat
ggcgtatcggcgacgcgcagcatcatggagcgctcgccgtgcgcgatcctcatcgtcacc
gcgaacgtcggcgcgaacgcgtcgtacgtctacgaggcgatgggcgcgggcgcgctcgac
gcggtcgacacgccgacgcttgagcagggcggcagcgccgatccgtcgcagccgctgctc
gcgaagatcgaccagatcggccggctgctcgcgacgcgcatgccgctcgccgcgcccgcc
gccgccgcgcccgcgccgcagggcgcgttgccgccgctcgtcgcgatcggcgcgtcggcg
ggcgggccgaccgcgctgaccgcgctgctgcggcggctgccggacgattttccggcggcg
ctcgtgatcgtccagcatgtcgaccaggcgttcgcgatcggcatggcgcagtggctcgac
ggctattcgccgttgccggtgcgcatcgcgcggcagggcagcgtgccgcaggcgggcgag
gtgctgctcgcggcgaccaacgatcacctgcatctgacgtcgcgcggggtgctcgcgtac
acgcggcgtccggaagagacgccgtaccggccgtcggtcgacgtgttctttcacagcgtc
gtcgatcactggaagggcgaggcgatcggcgtgctgctcacgggcatggggcgcgacggc
gcgctcggcctgaaggcgatgcgcacgaaggggcattacacgatcgcgcaggacgaagcg
acgagcgcggtgtacgggatgccgaaggccgcggccgcgatcggcgcggcgagcgcggtg
ctgccgctcgagcggatcgccgatcagttgatctcgctcgttcagcgcaacaggcagcgc
tggcgctga

DBGET integrated database retrieval system