KEGG   Burkholderia mallei NCTC 10247: BMA10247_A0404Help
Entry
BMA10247_A0404    CDS       T00479                                 

Definition
(GenBank) acetyltransferase, GNAT family
Organism
bmn  Burkholderia mallei NCTC 10247
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
II:356134..358497
Genome map
AA seq 787 aa AA seqDB search
MTVRNLDALFHPTSVAVVGASPRPGSVGAMVWACVLDGRFGGAIWPVNPKYGELNGHKVY
PYVDQLPSAPSVALICTPPATWPGIVRKLGGLGVRAAIIVGEARSGADRAALERALAAAK
PYLLRVVGPGSLGVVSPALGAHFGAPACIVKAGGVAWVSQSNALTNAVLGWAHARGLGFS
HAVALGGEADVDAADVLDYLASDAETRAILLELDTVKSARKFMSAARAAARNKPVLALRA
GRGDSGDLLYTAAFQRAGMVRVDALDDLLDEIEALGVGRAAATSGGVTLVTSDRGVAKLA
VDALAAAGETLAQWPRAAVDEVGGALPAGIVAGNPLLLGDDARPEYFGAALKALAQHPPT
GTVFVVHATSHSAPAVDVARVLIESRKFARRGMLACFFGGVDAATRDALHVHGIPVHTTP
QRLARAHARLVDYQLGRELLMQTPEGTPPQPAASISAARHTARAALAQGRDGFEGDAALE
WLAGFGIERATDADVDMGDTIVDITVGMYDDPNFGPVFRYSVPPADGVSAPFVVYGLPPF
NTVLARAVVARSPYAHRAPPEPLLQALTALSQAVCDVREIVEMSLVLRVRPTRVVALGPH
IRLATGRSRLAIVPYPRYLEQQLDWRGERITVRPIRPEDEAAHRELLSAMTPDDLRMRFF
GAIRNFDHSQIARMTQIDYDREMALIATLDDADGRAHTLGAVRAVTDPDNEATEFAIAVR
PDQKGKGLGRMLMTRIIDYARSRGTAWMIGEALRENTAMISLAKDSGFAVSSTEEPGVVA
FRLKLQP
NT seq 2364 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgttcgcaatctcgatgcgttgttccatccgacatccgttgccgtcgtcggcgct
tcgccgcgcccgggcagcgtcggcgcgatggtgtgggcgtgcgtgcttgacggccggttc
ggcggcgcgatctggcctgtcaacccgaagtacggcgaactgaacggccacaaggtttat
ccctatgtcgaccagctgccgagcgcgccgtcggtcgcgctcatatgcacgccgcccgcg
acgtggcccggcatcgtgcgcaagctgggcggcctgggcgtgcgtgcggcgatcatcgtc
ggcgaggctcgttcgggcgcagaccgggccgcgctggaacgggcgctcgccgcggcgaag
ccatatctgctgcgcgtcgtcgggccgggcagcctgggcgtggtgtcgcccgcgctgggc
gcgcatttcggcgcgccggcgtgcatcgtcaaggcgggtggcgtcgcatgggtgtcgcaa
tcgaatgcgctgacgaacgcggtgctcggctgggcgcatgcgcgcgggctcggtttctcg
catgcggtcgcactcggcggcgaggcggatgtcgacgcggccgacgtgctcgactacctg
gcgagcgatgccgagacacgcgcgatcctgctcgagctcgacacggtgaaatcggcgcgc
aagttcatgtcggcggcgcgcgccgcggcgcgcaacaagccggtgcttgcgttgcgcgcg
gggcgcggcgattcgggcgacctgctttacacggccgcgtttcagcgcgcggggatggtg
cgcgtcgacgcgctcgacgatcttctcgacgagatcgaggcgctcggcgtcggccgtgcc
gcggcgacgagcggcggggtgacgctcgtcacgagcgacaggggcgtcgcgaagcttgcc
gtcgacgcactcgcggcggcgggggaaacgctggcgcaatggccgcgggcggccgtcgac
gaagtcggcggcgcgctgcccgcgggcatcgtcgccggcaatccgttgctgctcggcgac
gacgcgcggcccgaatatttcggcgcggcgctgaaggcgctcgcgcagcatccgccgaca
ggcaccgtgttcgtggttcatgcgacgtcgcatagcgcgcctgccgtcgacgtcgcacgt
gtgctgatcgaatcgcgcaagttcgcgcgtcgcggcatgctcgcgtgcttcttcggcggc
gtcgacgccgcgacgcgcgacgcgctgcacgtgcacggcatccccgtgcacacgacgccg
cagcgtctcgcgcgcgcgcatgcgcgccttgtcgattatcaattgggccgggagctgttg
atgcagacgccggagggcacgccgccgcaaccggcggcgtcgatctcggccgcgcggcac
acggcgcgcgcggcgctcgcgcaggggcgcgacgggttcgaaggcgacgcggcgctcgaa
tggctggcgggtttcggcatcgagcgcgcgaccgacgcggacgtcgacatgggcgatacg
atcgtcgacatcacggtcgggatgtacgacgacccgaacttcgggccggtattccgctat
tcggtgccgccggcggatggcgtgtccgcgccgttcgtcgtctacgggctgccgcctttc
aataccgtgctcgcgcgcgcggtcgtcgcgcgatcgccgtatgcgcatcgcgcgccgccc
gagccgcttctgcaggcactgaccgcgctttcgcaggcggtgtgcgatgtgcgcgaaatc
gtcgagatgtcgctcgtgctgcgcgtgcggcccacacgcgtggtcgcgcttgggccgcac
atcaggctcgcgacggggcgcagccggctcgcgatcgtgccatatccgcgctatctcgag
cagcagctcgactggcgcggagaacgcatcacggtgcgtccgattcgccccgaggacgag
gccgcgcatcgcgagctgctgagcgcgatgacgccggacgatctgcgaatgcgcttcttc
ggtgcgatacgcaacttcgaccattcgcagatcgcgcggatgacgcagatcgattacgac
cgcgagatggcgctgatcgcgacgctcgacgatgccgacggccgcgcgcatacgctcggc
gcggtgcgcgcggtgaccgatccggacaacgaagcgacggagttcgcgatcgcggtgcgg
cctgaccaaaagggcaaggggctcggacggatgttgatgacgcgcatcatcgactacgcg
cgctcgcgcggaacggcgtggatgatcggcgaggcactgcgcgagaacacggcgatgatc
tcgctcgcgaaggatagcggttttgcggtgtcgtcgaccgaggagcctggggtggtggcg
ttccggctgaagctgcagccgtga

DBGET integrated database retrieval system