KEGG   Burkholderia mallei NCTC 10247: BMA10247_A0404Help
Entry
BMA10247_A0404    CDS       T00479                                 

Definition
acetyltransferase
Orthology
K01905  
acetyl-CoA synthetase (ADP-forming) [EC:6.2.1.13]
Organism
bmn  Burkholderia mallei NCTC 10247
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bmn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMA10247_A0404
   00620 Pyruvate metabolism
    BMA10247_A0404
   00640 Propanoate metabolism
    BMA10247_A0404
Enzymes [BR:bmn01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.13  acetate---CoA ligase (ADP-forming)
     BMA10247_A0404
Lipid biosynthesis proteins [BR:bmn01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BMA10247_A0404
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:356134..358497
Genome map
AA seq 787 aa AA seqDB search
MTVRNLDALFHPTSVAVVGASPRPGSVGAMVWACVLDGRFGGAIWPVNPKYGELNGHKVY
PYVDQLPSAPSVALICTPPATWPGIVRKLGGLGVRAAIIVGEARSGADRAALERALAAAK
PYLLRVVGPGSLGVVSPALGAHFGAPACIVKAGGVAWVSQSNALTNAVLGWAHARGLGFS
HAVALGGEADVDAADVLDYLASDAETRAILLELDTVKSARKFMSAARAAARNKPVLALRA
GRGDSGDLLYTAAFQRAGMVRVDALDDLLDEIEALGVGRAAATSGGVTLVTSDRGVAKLA
VDALAAAGETLAQWPRAAVDEVGGALPAGIVAGNPLLLGDDARPEYFGAALKALAQHPPT
GTVFVVHATSHSAPAVDVARVLIESRKFARRGMLACFFGGVDAATRDALHVHGIPVHTTP
QRLARAHARLVDYQLGRELLMQTPEGTPPQPAASISAARHTARAALAQGRDGFEGDAALE
WLAGFGIERATDADVDMGDTIVDITVGMYDDPNFGPVFRYSVPPADGVSAPFVVYGLPPF
NTVLARAVVARSPYAHRAPPEPLLQALTALSQAVCDVREIVEMSLVLRVRPTRVVALGPH
IRLATGRSRLAIVPYPRYLEQQLDWRGERITVRPIRPEDEAAHRELLSAMTPDDLRMRFF
GAIRNFDHSQIARMTQIDYDREMALIATLDDADGRAHTLGAVRAVTDPDNEATEFAIAVR
PDQKGKGLGRMLMTRIIDYARSRGTAWMIGEALRENTAMISLAKDSGFAVSSTEEPGVVA
FRLKLQP
NT seq 2364 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgttcgcaatctcgatgcgttgttccatccgacatccgttgccgtcgtcggcgct
tcgccgcgcccgggcagcgtcggcgcgatggtgtgggcgtgcgtgcttgacggccggttc
ggcggcgcgatctggcctgtcaacccgaagtacggcgaactgaacggccacaaggtttat
ccctatgtcgaccagctgccgagcgcgccgtcggtcgcgctcatatgcacgccgcccgcg
acgtggcccggcatcgtgcgcaagctgggcggcctgggcgtgcgtgcggcgatcatcgtc
ggcgaggctcgttcgggcgcagaccgggccgcgctggaacgggcgctcgccgcggcgaag
ccatatctgctgcgcgtcgtcgggccgggcagcctgggcgtggtgtcgcccgcgctgggc
gcgcatttcggcgcgccggcgtgcatcgtcaaggcgggtggcgtcgcatgggtgtcgcaa
tcgaatgcgctgacgaacgcggtgctcggctgggcgcatgcgcgcgggctcggtttctcg
catgcggtcgcactcggcggcgaggcggatgtcgacgcggccgacgtgctcgactacctg
gcgagcgatgccgagacacgcgcgatcctgctcgagctcgacacggtgaaatcggcgcgc
aagttcatgtcggcggcgcgcgccgcggcgcgcaacaagccggtgcttgcgttgcgcgcg
gggcgcggcgattcgggcgacctgctttacacggccgcgtttcagcgcgcggggatggtg
cgcgtcgacgcgctcgacgatcttctcgacgagatcgaggcgctcggcgtcggccgtgcc
gcggcgacgagcggcggggtgacgctcgtcacgagcgacaggggcgtcgcgaagcttgcc
gtcgacgcactcgcggcggcgggggaaacgctggcgcaatggccgcgggcggccgtcgac
gaagtcggcggcgcgctgcccgcgggcatcgtcgccggcaatccgttgctgctcggcgac
gacgcgcggcccgaatatttcggcgcggcgctgaaggcgctcgcgcagcatccgccgaca
ggcaccgtgttcgtggttcatgcgacgtcgcatagcgcgcctgccgtcgacgtcgcacgt
gtgctgatcgaatcgcgcaagttcgcgcgtcgcggcatgctcgcgtgcttcttcggcggc
gtcgacgccgcgacgcgcgacgcgctgcacgtgcacggcatccccgtgcacacgacgccg
cagcgtctcgcgcgcgcgcatgcgcgccttgtcgattatcaattgggccgggagctgttg
atgcagacgccggagggcacgccgccgcaaccggcggcgtcgatctcggccgcgcggcac
acggcgcgcgcggcgctcgcgcaggggcgcgacgggttcgaaggcgacgcggcgctcgaa
tggctggcgggtttcggcatcgagcgcgcgaccgacgcggacgtcgacatgggcgatacg
atcgtcgacatcacggtcgggatgtacgacgacccgaacttcgggccggtattccgctat
tcggtgccgccggcggatggcgtgtccgcgccgttcgtcgtctacgggctgccgcctttc
aataccgtgctcgcgcgcgcggtcgtcgcgcgatcgccgtatgcgcatcgcgcgccgccc
gagccgcttctgcaggcactgaccgcgctttcgcaggcggtgtgcgatgtgcgcgaaatc
gtcgagatgtcgctcgtgctgcgcgtgcggcccacacgcgtggtcgcgcttgggccgcac
atcaggctcgcgacggggcgcagccggctcgcgatcgtgccatatccgcgctatctcgag
cagcagctcgactggcgcggagaacgcatcacggtgcgtccgattcgccccgaggacgag
gccgcgcatcgcgagctgctgagcgcgatgacgccggacgatctgcgaatgcgcttcttc
ggtgcgatacgcaacttcgaccattcgcagatcgcgcggatgacgcagatcgattacgac
cgcgagatggcgctgatcgcgacgctcgacgatgccgacggccgcgcgcatacgctcggc
gcggtgcgcgcggtgaccgatccggacaacgaagcgacggagttcgcgatcgcggtgcgg
cctgaccaaaagggcaaggggctcggacggatgttgatgacgcgcatcatcgactacgcg
cgctcgcgcggaacggcgtggatgatcggcgaggcactgcgcgagaacacggcgatgatc
tcgctcgcgaaggatagcggttttgcggtgtcgtcgaccgaggagcctggggtggtggcg
ttccggctgaagctgcagccgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system