KEGG   Burkholderia mallei NCTC 10247: BMA10247_A0500Help
Entry
BMA10247_A0500    CDS       T00479                                 

Gene name
sdhD
Definition
succinate dehydrogenase, hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
bmn  Burkholderia mallei NCTC 10247
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bmn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BMA10247_A0500 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BMA10247_A0500 (sdhD)
   00650 Butanoate metabolism
    BMA10247_A0500 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    BMA10247_A0500 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:450418..450786
Genome map
AA seq 122 aa AA seqDB search
MAANNRIGSKRLVVGAHYGLRDWLAQRVTASVMAIYTVILLVWFFIARDFSYEGWASIFA
TQWMKLATFVTLLSLFYHAWVGVRDIWMDYIKPVGVRLLLQSLTIVWLLACAGYAAQILW
RV
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgaataaccgtatcggctcgaagcgcctcgtcgtcggcgcacactatggtctg
cgcgactggctggcgcagcgcgtcaccgcgagcgtgatggcgatctacaccgtcatcctg
ctcgtctggttcttcatcgcgcgcgatttctcgtacgagggctgggcgtcgatcttcgcg
acgcaatggatgaagctcgcgaccttcgtcacgctgctctcgctcttctatcacgcatgg
gtcggcgtgcgcgacatctggatggactacatcaagcccgtcggtgtgcgcctgctgctg
caatcgctgacgatcgtctggctgctcgcgtgcgcgggctacgctgcgcagattctctgg
agagtttaa

DBGET integrated database retrieval system