KEGG   Burkholderia mallei NCTC 10247: BMA10247_A0549Help
Entry
BMA10247_A0549    CDS       T00479                                 

Gene name
galU-2
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bmn  Burkholderia mallei NCTC 10247
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bmn00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BMA10247_A0549 (galU-2)
   00052 Galactose metabolism
    BMA10247_A0549 (galU-2)
   00500 Starch and sucrose metabolism
    BMA10247_A0549 (galU-2)
   00520 Amino sugar and nucleotide sugar metabolism
    BMA10247_A0549 (galU-2)
Enzymes [BR:bmn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BMA10247_A0549 (galU-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:497963..498940
Genome map
AA seq 325 aa AA seqDB search
MRAVRRARRRPARAPELWRAAIRQHFRDAIMLKVTKAVFPVAGLGTRFLPATKASPKEML
PVVDKPLIQYAVEEAINAGITEMIFVTGRSKRAIEDHFDKSFEIESELEARGKEKLLELV
RGIKPSHVDCFYVRQPAALGLGHAVLCAEKLVHGEPFAVILADDLLHGDQPVLKQLVDVF
NHYHSSVIGVETIEREDSRSYGIVEGREWEEDIIKLSGIIEKPAPEHAPSNLGVVGRYVL
MPSIFEHLRKIKPGAGGELQLTDAVQSLLTEEQVLAYRYYGTRFDCGSKLGYLKATVELA
LRHPEVGREFEAYLRNCLPALAAVA
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccgtgcgtcgagcgcggcgccgcccggcgcgcgctcccgagctttggcgtgcg
gccattcgtcaacactttcgggatgcgatcatgttgaaagtcaccaaagccgtgttcccc
gttgccggtctcggcacacggtttttgcccgccacgaaggcgagtccgaaggaaatgctg
cccgtggtcgacaagccgctgatccagtacgcggtcgaagaggcgatcaatgcgggcatc
accgagatgatcttcgtgacgggccgcagcaagcgcgcgatcgaagatcacttcgacaaa
tcgttcgagatcgaatccgagctcgaggcgcgcggcaaggaaaagctgctcgaactcgtg
cgcggcatcaagccgagccatgtcgactgcttctacgtgcgccagccggccgcgctcggc
ctcggccacgcggtgctctgcgcggagaagctcgtgcacggcgagccgttcgcggtgatc
ctcgccgacgacctgctgcacggcgaccagccggtgctcaagcagctcgtcgacgtcttc
aaccactatcacagctcggtgatcggcgtcgagacgatcgagcgcgaggacagccgctcg
tacggcatcgtcgaaggccgcgagtgggaagaggacatcatcaagctgtcgggcatcatc
gagaagccggcgcccgagcatgcgccgtcgaacctcggcgtcgtcggccgctacgtgctg
atgccgagcatcttcgagcatctgcgcaagatcaagccgggcgcgggcggcgaactgcaa
ctgacggacgcggtgcagtcgctgctgaccgaggagcaggtgctcgcgtaccgctactac
ggcacccgtttcgactgcggcagcaagctcggctatctgaaggcgacggtcgagctcgcg
ctgcggcatccggaagtgggccgcgaattcgaggcgtacctgcgcaactgcctgccggcg
ctcgccgcggttgcttag

DBGET integrated database retrieval system