KEGG   Burkholderia mallei NCTC 10247: BMA10247_A0686Help
Entry
BMA10247_A0686    CDS       T00479                                 

Gene name
bcsC
Definition
endo-1,4-D-glucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
bmn  Burkholderia mallei NCTC 10247
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BMA10247_A0686 (bcsC)
Enzymes [BR:bmn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     BMA10247_A0686 (bcsC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:633152..634465
Genome map
AA seq 437 aa AA seqDB search
MASFSVMAFAAATLPVSWRVAAAAERTRSGGERAGGLRDTAGLIEISAAAPASTPIPAAP
RRFAQPFAQPARAFAVASACAPSWPRWDRFKRDFVSADGRVIDVGSADERTVSEGQAYGL
FFALVANDRAAFDALLRWTEDNLAQGDLSARLPAWLWGRAADGAWRVLDANAASDADLWL
AYALLEAGRLWRERSYTARGALLAKRVLDEETATLPGLGLVLLPGPMGFRPARDAWRLNP
SYSPPQAIRGIGAHVPDDARWARLAAGFGRVLTDSAPRGFAPDWALYRAGRGFEPDAETH
AVSAYNAIRVYLWAGMLDAGDPLARPLVAHFAPFAEHVAAHGAPPEAVDATTGAAAPRDG
NAGFSAAAVPFLEARGERASADAQLARVARLERETASGYYANVLTLFGLGWRDGRYRFAA
DGTLRVRWSEPCSTPAR
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
gtggcgagcttctcggtgatggcgttcgcggcggcgacgttgccggtgtcgtggcgcgtc
gccgcggcggcggagcgtacgcgaagcggcggcgaacgcgcgggcgggctgcgcgacacg
gcgggcttgatcgagatctcggcggcggcgccggcctcgacgccgatcccggcggcgccg
cggcggttcgcgcagccgttcgcgcagccggctcgcgcgttcgccgtcgcgagcgcctgc
gcgccgtcctggccgcgctgggaccgtttcaagcgtgacttcgtatcggccgacggccgc
gtgatcgacgtcggctcggccgacgagcggaccgtatccgaggggcaggcgtacggcctt
ttcttcgcgctcgtcgcgaacgaccgcgcggcgttcgacgcgctgctgcgctggaccgag
gacaatctcgcgcagggcgatctgagcgcgcgtctgcccgcgtggctgtggggccgcgcg
gccgacggcgcgtggcgcgtgctcgatgcgaacgccgcgtccgacgccgatctgtggctt
gcgtacgcgctgctcgaagcggggcgcttgtggcgcgagcgcagctacacggcgcgcggc
gcgttgctcgcgaagcgcgtgctcgacgaggagaccgcgacgctgccggggctcggtctc
gtgctgctgccgggcccgatgggttttcggccggcgcgcgacgcgtggcggctgaatccg
agctattcgccgccgcaggcgattcgcgggatcggcgcgcatgtgcccgacgacgcgcgc
tgggcgcggctcgcggcgggcttcggccgcgtgctgaccgacagcgcgccgcgcggcttc
gcgccggactgggcgctgtatcgcgcgggccgcggcttcgagccggacgccgaaacgcat
gcggtgagcgcgtacaacgcgattcgcgtctatctgtgggcgggcatgctcgatgcgggc
gatccgctggcgcggccgctcgtcgcgcatttcgcgccgttcgccgagcatgtcgccgcg
catggcgcgccgccggaggcggtcgatgcgacgacgggcgcggccgccccgcgcgacggc
aatgccgggttttccgcggcggccgtgccgtttctcgaggcgcgcggcgagcgggcgagc
gccgacgcgcagctcgcgcgcgtcgcgcggctcgagcgcgagacggcgagcggctattac
gcgaacgtgctgacgctgttcgggctcggctggcgcgacgggcgctaccggttcgcggcc
gacggcacgctgcgggtgcgatggagcgagccgtgctcgacgcccgcgcgttga

DBGET integrated database retrieval system