KEGG   Burkholderia mallei NCTC 10247: BMA10247_A1535Help
Entry
BMA10247_A1535    CDS       T00479                                 

Gene name
asnB-1
Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bmn  Burkholderia mallei NCTC 10247
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bmn00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(1483642..1485612)
Genome map
AA seq 656 aa AA seqDB search
MCGITGFVGPVACAPQTARATLARMTDSLAHRGPDDTGLWIDHDAGVALGHRRLSIVDLS
EHGHQPMLSACGRYAMTFNGEIYNFRQLRSELEREHRAPEWRGHSDSEVLLAAFCAWGVD
RALQKAVGMFALALWNRESRVLTLARDRIGEKPLYYGRIGGSFVFGSELKALRRFPGFDA
HPIDRDALCLYLRHASVPAPYTIYEGIRKLPPGTYAQLEDLAEAPAPRRYWSLERAIAAG
RANPFDGDANAAVAQLDYVLRDAIAEQSVADVPLGAFLSGGVDSSVIVALMQTQTAQPVQ
TFTIGFHEAGYDEAGYAKAVARHLGTSHTELYVKPADVLATVPRMPCVYDEPFADSSQIP
TLLVSELTRRHVKVSLSGDGGDELFGGYTRYFLTPRLWGRLRRVPAAVRMRIAAALHALR
PDHADQIASLVQGAWSASAQRDASPRVGDRLHKLANVMTADSRASLYRLLMSSVHHPERF
TLAGHEPQTLIDTPGAWPAGLSFAEQAMAVDTLTYLPTDILTKVDRAAMAVSLETRMPFL
DHRVVEFAWRLPEALRIPDGQDKWLLRKLLYRYVPRPLIDRPKQGFCAPVGAWLRGELSD
WAAELLRPARLRDEGYLDAARVERLWRQHQSGRMNWQHPLWTVLMFQAWLERQRAE
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaatcaccggcttcgtgggccctgtcgcatgcgcgccgcagacggctcgcgcg
accctcgcgcgaatgacggacagtctcgcgcatcgcggcccggacgataccggtttgtgg
atcgatcacgacgcgggcgtcgcgctcggccatcggcgcctgtcgatcgtcgacttgtcc
gagcacgggcatcagccgatgctgtccgcgtgcggccgttatgcgatgacgttcaacggc
gagatctacaactttcgccagttgcgcagcgagctcgagcgcgaacatcgcgcgcccgaa
tggcgcggtcattcggatagcgaagtgttgctcgcggcgttctgcgcgtggggcgtcgat
cgcgcgttgcaaaaggcggtcggcatgttcgcgctcgcgctgtggaaccgcgaatcgcgc
gtgctcacgctcgcgcgcgatcgcatcggcgagaagccgctctattacggccgcatcggc
ggctcgttcgtgttcggctccgagctgaaggcgctgcggcgttttcccggcttcgacgcg
catccgatcgaccgcgacgcgctgtgcctgtatctgcgccacgcgagcgtgcccgcgccg
tacacgatctacgaaggcatccgcaagctgccgcccggcacgtacgcgcagctcgaggac
ctcgccgaagcgcccgcgccgcgccgctactggtcgctcgagcgcgcgatcgccgcaggc
cgcgcgaatccgttcgacggcgacgcgaacgccgccgtcgcgcagctcgattacgtgttg
cgcgacgcgatcgccgagcagtcggtcgccgacgtgccgctcggcgcgttcctgtcgggc
ggcgtcgattcgtcggtgatcgtcgcgctgatgcagacgcagaccgcgcagccggtgcag
accttcacgatcggctttcacgaggcgggctacgacgaggccggctatgcgaaggcggtt
gcgcggcatttgggcacgtcgcacaccgagctctacgtgaagccggccgacgtgctcgcg
accgtcccgcgcatgccgtgcgtctacgacgagccgttcgccgattcgtcgcagattccg
acgctgctcgtttccgagctcacccgccggcacgtgaaggtgagcctgtccggcgacggc
ggtgacgagctgttcggcggctacacgcgctatttcctgacgccgcgcctatgggggcgg
ctgcgccgcgtgccggccgcggtgcggatgcggatcgcggccgcgctgcacgcgctgcgg
cccgaccatgcggatcagatcgcctcgctcgtgcagggcgcgtggagcgcgtccgcgcag
cgcgacgcgtcgccgcgcgtcggggaccgcctgcacaagctcgcgaacgtgatgacggcg
gacagccgcgcgtcgctgtaccggttgctgatgtcgtcggtccatcatccggagcgcttc
acgctcgcggggcacgagccgcagacgctgatcgacacgccgggcgcgtggcccgccggg
ctgtcgttcgccgagcaggccatggccgtcgatacgctcacgtatctgccgaccgacatc
ctgacgaaagtcgaccgcgcggcgatggcggtgagcctcgagacgcggatgccgtttctc
gatcaccgcgtcgtcgagttcgcgtggcggctgccggaggcgctgcgcatcccggatggg
caggacaagtggttgctgcgcaagctgctgtatcgctacgtgccgcgcccgctgatcgac
cggccgaaacagggcttctgcgcgcccgtcggcgcgtggctgcgcggcgaattgagcgac
tgggcggcggagctgctgcgccccgcgcgcctgcgcgacgaaggctacctcgacgcggcg
cgcgtcgagcgcctgtggcggcagcaccagtcgggccggatgaactggcagcacccgctc
tggacggtgctgatgttccaggcatggctcgagcggcagcgcgccgagtag

DBGET integrated database retrieval system