KEGG   Burkholderia mallei NCTC 10247: BMA10247_A1698Help
Entry
BMA10247_A1698    CDS       T00479                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
bmn  Burkholderia mallei NCTC 10247
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bmn00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:1636699..1637382
Genome map
AA seq 227 aa AA seqDB search
MASVPEKCCGFFWRCDVMIDTQYNGACDVHHHSPAEIRRIRQFDPAAFEMAVGSLLMACG
IEIDAAHTSRTAQRVRELWQKRLLDGYDVDPAEALGVGFDDRKEDMVIIRSIAVHGVCPH
HLLPFRGVAHVAYLPGGRLHGFGRIARMIDAISHRFTYQEWITNEIATALVTHGKARGAA
CLIEAEQLCLLMGENRRGDERVITQCYVGEFDHNAQARNEFLRAINR
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcgttcccgaaaaatgttgtggattcttttggagatgtgatgtcatgattgac
acccaatacaatggcgcatgcgatgtccaccaccattctccggccgaaattcgacgcatc
cgccagttcgatcccgccgcattcgaaatggcggtcggtagcttgctcatggcctgtggt
atcgagatagacgccgcacataccagccgcacggcgcaacgtgtgcgggaactctggcag
aagcgcttgcttgacggctacgatgttgatcctgcagaggcgctgggtgtgggtttcgat
gatcgaaaggaagatatggtcatcatccgcagtatcgctgtccatggtgtttgtccgcat
cacttgttgccatttcgcggcgtggcacacgtggcctatctgccgggagggcgactgcat
ggcttcgggcgcatcgcccgtatgatcgatgcgatcagccatcgatttacataccaagag
tggattacaaacgagattgcgacagcccttgtcactcatggaaaagcacggggagcagct
tgcctgatcgaagccgaacaactgtgcttgctcatgggcgaaaatcgccgcggcgacgag
cgcgtaattacgcaatgctacgtgggcgaatttgaccataacgcccaggcgcgcaacgag
tttcttcgcgccatcaatcgatag

DBGET integrated database retrieval system