KEGG   Burkholderia mallei NCTC 10247: BMA10247_A1899Help
Entry
BMA10247_A1899    CDS       T00479                                 

Definition
(GenBank) putative enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bmn  Burkholderia mallei NCTC 10247
Pathway
bmn00071  Fatty acid degradation
bmn00280  Valine, leucine and isoleucine degradation
bmn00281  Geraniol degradation
bmn00310  Lysine degradation
bmn00360  Phenylalanine metabolism
bmn00362  Benzoate degradation
bmn00380  Tryptophan metabolism
bmn00410  beta-Alanine metabolism
bmn00627  Aminobenzoate degradation
bmn00640  Propanoate metabolism
bmn00650  Butanoate metabolism
bmn00903  Limonene and pinene degradation
bmn00930  Caprolactam degradation
bmn01100  Metabolic pathways
bmn01110  Biosynthesis of secondary metabolites
bmn01120  Microbial metabolism in diverse environments
bmn01130  Biosynthesis of antibiotics
bmn01212  Fatty acid metabolism
Module
bmn_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bmn00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BMA10247_A1899
   00650 Butanoate metabolism
    BMA10247_A1899
  Lipid metabolism
   00071 Fatty acid degradation
    BMA10247_A1899
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BMA10247_A1899
   00310 Lysine degradation
    BMA10247_A1899
   00360 Phenylalanine metabolism
    BMA10247_A1899
   00380 Tryptophan metabolism
    BMA10247_A1899
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BMA10247_A1899
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BMA10247_A1899
   00281 Geraniol degradation
    BMA10247_A1899
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BMA10247_A1899
   00627 Aminobenzoate degradation
    BMA10247_A1899
   00930 Caprolactam degradation
    BMA10247_A1899
Enzymes [BR:bmn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BMA10247_A1899
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ABO02391
Position
II:complement(1831366..1832142)
Genome map
AA seq 258 aa AA seqDB search
MAYENILVETRGRVGLITLNRPKALNALNDALMDELGLALKAFDADEGIGAIVLTGSEKA
FAAGADIGMMATYSYMDVFKGDYITRNWETVRQIRKPIIAAVAGFALGGGCELAMMCDII
FAADTAKFGQPEIKLGVLPGAGGTQRLPRAVSKAKAMDMCLTARFMDAEEAERAGLVSRI
LPADKLLDEAIAAATTIAEFSLPAVMMVKEAVNRAYETTLSEGVHFERRLFHSAFATEDQ
KEGMAAFVEKRKPVFKHR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggcttacgagaacattctggtggagacgcggggcagggtggggctgattacgctgaac
cgtccgaaggcgctgaatgcgttgaatgacgccctgatggatgaacttggcttggcgctc
aaagcgttcgacgcggacgagggtattggcgcgatcgtgctgacgggcagcgagaaggcg
ttcgcggcgggcgccgacatcgggatgatggcgacctattcatacatggacgtcttcaag
ggcgactacatcacgcgtaactgggagacggtgcgccagatccgcaagccgatcatcgcg
gcggtggcgggtttcgcgctgggcggcggctgcgaactcgcgatgatgtgcgacatcatc
tttgcggccgatacggcgaagttcggccagccggaaatcaagctcggcgtgctgccgggt
gcgggcggcacgcagcgcctgccgcgcgcggtgtcgaaggcgaaagcgatggacatgtgc
ttgaccgcgcgcttcatggacgcggaggaggctgagcgggcgggcttggtgtcgaggatc
ctgccggcggacaagttgctcgacgaggcgatcgccgcggcgacgacgatcgcggaattc
tcgctgcctgccgtaatgatggtgaaggaggcggtgaatcgcgcatacgagacgaccttg
tccgaaggggtgcacttcgagcgtcgcttgtttcactcggcatttgcgactgaagatcag
aaggaagggatggcggcgttcgtcgagaagcgcaagcccgtcttcaagcatcgctga

DBGET integrated database retrieval system