KEGG   Burkholderia mallei NCTC 10247: BMA10247_A1913Help
Entry
BMA10247_A1913    CDS       T00479                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bmn  Burkholderia mallei NCTC 10247
Pathway
bmn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bmn01100  Metabolic pathways
bmn01110  Biosynthesis of secondary metabolites
bmn01130  Biosynthesis of antibiotics
bmn01230  Biosynthesis of amino acids
Module
bmn_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bmn00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BMA10247_A1913 (trpC)
Enzymes [BR:bmn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     BMA10247_A1913 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C FMN_dh
Motif
Other DBs
NCBI-ProteinID: ABO03008
UniProt: A3MFQ4
Position
II:1845143..1845928
Genome map
AA seq 261 aa AA seqDB search
MSDILDKIIAVKREEIAAALESAPLEELKVQASARDSRDFVGALRDKHAAGHAAVIAEVK
KASPSKGVLREHFVPADIARSYAQHGAACLSVLTDERFFQGSARYLEQARAACTLPVLRK
DFIVDAYQLLEARAMGADAILLIAAALDTPLMIDLEAYAHSLGLAVLVEVHNRGELDEAL
KLKTPFVGINNRNLRTFETTIDTTLGMLDAIPDDRIVVTESGILSRADVERMEAAGVHTF
LVGEAFMRAENPGAELARMFF
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacatcctcgacaaaatcatcgccgtcaagcgcgaagagatcgccgccgcgctc
gagagcgcgccgctcgaagaactgaaggtgcaggcgtcggcgcgcgattcgcgcgacttc
gtcggcgcgctgcgcgacaagcacgcggccggacacgccgccgtcatcgccgaggtgaag
aaggcgagcccgtcgaaaggcgtgctgcgcgagcatttcgtgccggccgacatcgcccgc
tcgtacgcgcagcacggcgccgcatgcctgtcggtgctgaccgacgagcggttcttccag
ggcagcgcgcgctatctcgaacaggcgcgcgccgcgtgcaccctgcccgtgctgcgcaag
gacttcatcgtcgacgcgtaccagctgctcgaagcgcgcgcgatgggcgcggacgcgatc
ctgctgatcgccgcggcgctcgacacgccgctgatgatcgatctcgaggcgtacgcgcat
tcgctcgggctcgcggtgctcgtcgaagtgcacaaccgcggcgaactggacgaagcgttg
aaactgaagacgccgttcgtcggcatcaacaaccgcaacctgcgtacattcgagacgacg
atcgacacgacgctcggcatgctcgacgcgattccggacgatcggatcgtcgtcaccgaa
tccggcatcctgtcgcgcgcggacgtcgagcggatggaggcggcgggcgtgcatacgttc
ctcgtcggcgaagcgttcatgcgcgccgagaacccgggcgcggaactcgcgcggatgttc
ttctga

DBGET integrated database retrieval system