KEGG   Burkholderia mallei NCTC 10247: BMA10247_A2237Help
Entry
BMA10247_A2237    CDS       T00479                                 

Definition
dihydroflavonol-4-reductase family protein
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
bmn  Burkholderia mallei NCTC 10247
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:2175904..2176911
Genome map
AA seq 335 aa AA seqDB search
MTDIQRDLVLVTGASGFVGSAVARAARRQGYRVRVLVRLTSPRTNVADLDAEIATGDMRD
EASMRAALRGVRHLLHVAADYRLWAPDPLEIERANLEGAVATMRAALAEGVERIVYTSSV
ATLKVTPSGASADESSPLAAGQAIGVYKRSKVLAERAVERMIAEDGLPAVIVNPSTPIGP
RDVKPTPTGRIIVEAALGKIPAFVDTGLNLVHVDDVAQGHLLALERGRVGERYILGGENL
PLQAMLADIAQSTGRKPPTIALPRWPLYPIALGAEAVAKLTKREPFVTVDGLRMSKNKMY
FTSAKAERELGYRARPYREGIRDALDWFRQAGYLR
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgactgacatacaacgcgatctcgttctggtgaccggcgcatccggttttgtcggctcc
gccgtcgcgcgcgccgcgcggcggcagggctatcgggtgcgcgtgctcgtgcggctgacg
agcccgcgcacgaacgtcgcggatctcgacgccgagatcgccaccggcgacatgcgcgac
gaggcatcgatgcgcgccgcgctgcgcggcgtgcgccatctgctgcacgtcgccgccgac
taccggctgtgggcgcccgatccgctcgagatcgagcgcgcgaatctcgaaggcgcggtc
gcgacgatgcgcgcggcgctcgccgagggcgtcgagcggatcgtctacacgagcagcgtc
gccacgctgaaggtgacgccgtcgggcgcctcggccgacgaatcgtcgccgctcgccgcc
gggcaggcgatcggcgtatacaagcgcagcaaggtgctcgccgagcgcgcggtcgagcgg
atgatcgccgaggacgggctgcccgcggtgatcgtcaatccgtcgacgccgatcggcccg
cgcgacgtgaagccgacgccgaccggccggatcatcgtcgaggcggcgctcggcaagatc
ccggcgttcgtcgacacggggctgaacctcgtgcacgtcgacgacgtcgcgcagggccac
ctgctcgcgctcgagcgcgggcgcgtcggcgagcgctacatcctcggcggcgagaacctg
ccgctgcaggcgatgctcgccgacatcgcgcaatcgacgggacgcaagccgccgacgatc
gcgctgccgcgctggccgctgtatccgatcgcgctcggcgcggaggcggtggcgaagctg
acgaagcgcgagccgttcgtgacggtcgacgggctcaggatgtcgaagaacaagatgtat
ttcacgtccgcgaaagccgagcgcgagctcggctaccgcgcgcggccgtaccgcgaaggc
attcgcgacgcgctcgactggttcaggcaggcgggctatctgcgctga

DBGET integrated database retrieval system