KEGG   Bombyx mori (domestic silkworm): 100127056Help
Entry
100127056         CDS       T02817                                 

Gene name
Cpr, bCPR
Definition
(RefSeq) NADPH cytochrome P450 reductase
  KO
K00327  NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
bmor  Bombyx mori (domestic silkworm)
Brite
Enzymes [BR:bmor01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     100127056 (Cpr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_1 Flavodoxin_1 NAD_binding_1 Glyco_tran_WecB
Motif
Other DBs
NCBI-GeneID: 100127056
NCBI-ProteinID: NP_001104834
UniProt: Q9NKV3
Position
Un
AA seq 687 aa AA seqDB search
MSENAQDLLKDAAAGAAAAAAAGGSLFSTFDIIVLALLLGGTIWWFYNSKKESKRDKILL
EKYSIQAAGSIQVTENSFITKLKTSGRSLVVFYGSQTGTAEEFAGRLAKEGMRYKMKGMV
ADPEECDMEELTKLQEIENSLAVFCMATYGEGDPTDNSMEFYEWLKNQDPDLTGLNYAVF
GLGNKTYEHYNAVAIYLDKRLEELGATRVYELGMGDDDANIEDDFITWKDKFWPAVCEKY
NIESAGEEELTRQFRHVLHPPDEVSPNSVFTGEIAKLHSLQVQRPPYDSKNPFLAQITVN
RELHRGGDRSCLHVELDISDSKMRYEAGDHVAVYPINDMDLVERLGQLTNANLDEIFSLI
NTDQESSKKHPFPCPTSYRTALSHYVEITALPRTHILRELVEYCSNEEDKKKLLLMATNT
QEGKSLYQSFVVDACRNIVHILEDLPSCKPPLDHICELLPRLQPRYYSISSSPKLHPETV
HITAVVVKYKTPTGRINKGVATTWLAQHKPEPGKPLPRVPVYIRKSQFRLPMQTQTPIIM
VGPGTGLAPFRGFLQDRAFVRASGKEVGENILYFGCRHRDEDYIYQEELEEYEKNGDVKL
NLAFSRDQANKVYVTHLLENNMDELWDVIGNRNGNFYICGDAKNMAVDVRNIVLKAIKEK
GGRTETEAVQFLKKLESVKKYSSDVWS
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaaatgcacaagacttactgaaagatgcagctgccggtgccgccgctgcagcc
gctgctggtggatcactattcagcacatttgacataattgtgttggcattgttgttggga
ggtactatatggtggttttacaattcaaaaaaagaaagcaagcgggacaaaatacttctg
gaaaaatactcaattcaagcagcaggatctatacaagtcacagaaaactcttttataaca
aaattaaagacttcgggaaggagtttagtagtgttctatggatctcagacgggtactgcg
gaagaattcgctggtcgacttgccaaagaaggcatgcgctataaaatgaagggtatggtg
gctgatccagaagaatgtgatatggaagaactcacaaagctacaagaaattgaaaactcc
ctggctgttttctgtatggcaacatacggtgagggagaccccacagataattcaatggaa
ttttatgaatggttaaaaaatcaagatccagatctgactggcctaaattacgcagtattt
gggcttggtaataaaacatatgagcattataatgcagtggccatttatttagataaaaga
ttagaagaacttggagctacacgagtatatgaattgggaatgggtgatgatgatgctaat
attgaagatgacttcattacgtggaaagataaattttggccagcggtatgtgagaaatac
aacattgaaagtgcaggagaagaagaactcacgagacagttccgtcacgtgctccatcca
cctgatgaagtttctcctaacagtgtgttcactggtgaaattgctaagctacactcgcta
caagttcaaagaccaccatatgattctaaaaatccattcttggcacagattactgtcaac
agagaactacatcgtggtggtgacagatcatgtttgcatgtagaattagacatatctgat
tctaaaatgcgatatgaagctggtgatcatgtagctgtgtatcctatcaacgatatggat
ttagtagagcgcttgggacaactgacaaatgccaatctcgatgaaatattttcgcttatc
aacactgaccaggaaagcagcaagaaacatccattcccttgtccaacatcttacagaact
gctctctcgcattatgtagaaattacagcattaccgcgtacccacatcctccgagagttg
gttgaatattgttctaatgaagaagataagaagaagctgcttctgatggccacaaacact
caagagggaaaatccctgtatcagtcgtttgtagttgatgcttgtagaaatattgtgcac
atattggaagacctaccgtcatgtaaacctcccttggatcatatttgtgaacttttgccc
cggttacaaccaagatactattcgatttcttctagtcctaagcttcatccagagacggtg
cacattactgcggtcgtcgtaaagtacaagactccgaccggacgaatcaacaaaggtgtc
gctacgacgtggcttgctcaacataaacccgagccggggaaaccactgcctcgtgtcccg
gtttatataaggaaatctcagttcaggcttccaatgcagacccaaacaccaataataatg
gtgggaccggggactggattggcgcccttccgaggttttcttcaagaccgcgcattcgtc
cgcgccagtgggaaagaagtgggcgagaacatcctttactttggatgcagacatcgtgat
gaggattacatctaccaagaggaactagaggaatacgaaaagaatggtgacgtaaaactg
aacttagcattttcacgcgaccaagcgaacaaagtttacgttacacatttactcgaaaat
aatatggacgaactatgggatgttatcggaaataggaatggaaatttctacatttgcggt
gacgcgaaaaacatggctgtggacgtaaggaacattgtgttgaaagctataaaagagaaa
ggcggccgcacagagacggaggccgtgcagttcctcaagaagttagaatccgtcaagaaa
tattcttcggacgtttggagttaa

DBGET integrated database retrieval system