KEGG   Bombyx mori (domestic silkworm): 100379324Help
Entry
100379324         CDS       T02817                                 

Gene name
Amy
Definition
alpha-amylase (EC:3.2.1.1)
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
bmor  Bombyx mori (domestic silkworm)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmor00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100379324 (Amy)
Enzymes [BR:bmor01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     100379324 (Amy)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 500 aa AA seqDB search
MFRYILLLSAVTLALAYKNPHYASGRTTMVHLFEWKWDDIAAECERFLGPRGFGGIQVSP
PNENLVIWSRNRPWWERYQPISYRLVTRSGNENQFSNMVRRCNNVGVRIYVDAIINHMTG
TWNENVGTGGSTANFENWHYPAVPYGRNDFNWPHCVITGSDYNCCPDRVRNCELSGLKDL
NQGSDYVRQQILNYMNRLIDMGVAGFRIDAAKHMWPHDLRVIYDRLRNLNTAHGFPSGAR
PYIYQEVIDLGGEAISRNEYTPLAAVTEFRFGLELSQAFQRRNQLRWLVNWGPQWGLLAS
GDALTFIDNHDNQRGHGAGGNILTYKQSRQYKGAIAFMLAHPYGYPQLMSSFAFTDTEAG
PPMNSRGDITSPTINADNSCGNGWICEHRWRQIHNMVVFRNTAGNGALTNWWDNGSNQIA
FCRGNQAFIAFNNDAWDMDQTLQTCLPAGTYCDIISGARSGNRCTGKSIVVGSDGRALII
HRSNEYDMMVAIHRGADSRL
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgtttcggtacatccttctactttcggccgtgactctggcgttggcctataaaaaccct
cactatgcatcgggtcgcaccaccatggtacatctcttcgaatggaagtgggatgacatc
gctgctgaatgcgaaaggttccttggaccccgaggattcggtggtattcaggtttcgcca
ccaaacgagaatttggtaatctggtcccgcaaccgtccttggtgggagcgctatcaacca
atctcctaccgtctagtaacaagatctggaaatgaaaatcaattttcgaatatggtgcgt
cgctgcaacaatgttggcgtcaggatttatgtggacgccatcatcaaccacatgactgga
acttggaatgagaatgttggtacaggtggaagcacggccaatttcgaaaactggcactat
cctgctgttccttacggcaggaatgacttcaactggcctcattgtgtcattactggcagc
gactacaactgctgccctgacagagtgcgcaactgtgaattgtctggtctgaaagacttg
aaccaaggctctgattatgttagacagcagattctaaattatatgaaccgtcttattgac
atgggtgttgctggtttcagaattgatgctgcaaagcacatgtggcctcacgatttgcga
gtgatctacgatcgtctccgcaatttaaataccgcccacggtttcccatccggtgctcgt
ccctacatctaccaagaagtcatcgacctcggtggtgaagctatcagtcgcaacgaatac
actccacttgctgccgttactgagttcagatttggactggaactcagtcaagctttccaa
agaagaaaccagcttagatggttggttaactggggtccacagtggggccttctcgcttct
ggagacgctttgactttcattgacaaccacgacaaccagagaggtcatggcgctggtgga
aacatcttgacatacaagcaatcccgacaatacaagggcgctatcgctttcatgttggca
catccttatggctaccctcaattgatgagtagtttcgccttcacggacaccgaagctgga
cctccaatgaacagcaggggtgatatcacctctcctactatcaacgctgataattcttgc
ggcaatggttggatatgcgagcaccgttggcgtcagatccacaacatggttgtcttcagg
aacaccgctggtaacggtgcccttaccaactggtgggacaacggtagcaaccagattgct
ttctgccgcggcaaccaggccttcattgctttcaacaacgatgcatgggacatggaccag
actcttcagacttgtctccccgccggaacatactgcgatattatttccggcgccaggtct
ggtaaccgctgcactggaaaatctattgtagtaggcagcgatggtcgcgctcttatcatc
caccgcagcaacgagtatgacatgatggttgctatccataggggtgctgactcgagattg
taa

DBGET integrated database retrieval system