KEGG   Bombyx mori (domestic silkworm): 100379464Help
Entry
100379464         CDS       T02817                                 

Gene name
CPH33, BmorCPH33
Definition
(RefSeq) cuticular protein hypothetical 33
Organism
bmor  Bombyx mori (domestic silkworm)
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
Un
AA seq 146 aa AA seqDB search
MIAFKTTVVLLLVALASARPSEEWEPEGHTHTEHTKPYHVTVVKKIGVPIPHPVAVSVPQ
YVKVPIPQPYPVHVTVEQPIHVPVYKVVHQVVEKPVPYTVEKPVPYEVEKPYPVEVEKKV
EVPIPKPYPVHVPVYKHIYHHKGGKH
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcttttaaaacaacagtcgtccttctcttagtagcgctcgccagcgctcggcct
tctgaagaatgggagcccgaaggccacacgcacacagaacacacgaagccgtaccatgtg
accgtggtgaagaagatcggagttccgattccccatccggtggctgtgtcggtcccgcag
tacgtgaaggtgcccatacctcaaccctacccggtccacgtcacagtggagcaacctatc
catgtacctgtttataaggttgtccaccaagttgttgaaaaaccagtaccgtacacggtc
gaaaaaccagtgccctatgaagtcgaaaagccttatcccgttgaggtcgaaaaaaaagta
gaggtgcccatccctaagccctatcccgtccatgtacccgtgtacaaacacatctaccac
cataagggaggtaaacactaa

DBGET integrated database retrieval system