KEGG   Bombyx mori (domestic silkworm): 100862766Help
Entry
100862766         CDS       T02817                                 

Gene name
Tbh
Definition
tyramine beta hydroxylase
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
bmor  Bombyx mori (domestic silkworm)
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmor00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    100862766 (Tbh)
Enzymes [BR:bmor01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     100862766 (Tbh)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 592 aa AA seqDB search
MSNWFFVFFLSVYTFIYTFSVNVSPGHRFAESESVLDPSGEFLLKWRVDYAVRKIKFTLT
VSEKAPAFNWFALGFSDRGQLNNSDVCLFWTDYKARDHFEDMHTNGQGNLIRDQKQNCEG
FYLNTNSQSIIFDRLFDTCDDDDYVIEDGTVHVVWAHGIDKLFSSKGLCLTCTVPQRHGF
VRVRLLTPPGLQKANGYQLRITNKDLKVPGDDTTYWCKVVRLPEFVTSKVHHIVQFESTI
TPGNEGLVHHMEVFYCDEDPHKEMPAYEGNCFAAERPAITKSCSKVKAAWAMGAPPFTYP
KEAGLPLGGPKANKYVMLEVHYNNPELRKDWVDSSGIVLYITGRKRTYDAAIMELGLEYT
DKMAIPGEQKAFPLTGYCIPQCTGVGLPDEGITVFGSQLHTHLTGAAVWTRHSRQGVELP
VLNKDMHYSTHFQEIRILHRPVKVLPGDFLETTCIYNTEDKLNATIGGHAITDEMCVNYI
HYYPATELEVCKSAVSNEALEKYFDFEKRWDDIPISSKATPRDNYLAIQPWTRLRADTLH
TLYVESPISMQCNKSDGSRFQGDWEGIPIPKIKLPLSEEIRICPKINYLVET
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaattggttttttgtgttttttctgtctgtttatacatttatttatacgttttct
gtgaacgtaagcccaggtcatcgtttcgctgaaagtgaatcagtgttggatccaagcggc
gagtttttattaaagtggcgtgttgattatgccgttcgaaagattaaatttactttgact
gtttctgaaaaagcgccggccttcaattggtttgcattaggcttctccgatcggggccaa
ctgaataattcggatgtttgtctgttttggacagattataaagctcgtgatcatttcgag
gatatgcacacaaacggacaggggaatttgatacgtgatcaaaaacaaaactgtgaaggg
ttttatttgaatacaaatagccaaagcataatctttgatcgtttatttgatacttgcgat
gatgatgattacgtgattgaggacggcacagtccatgtggtgtgggctcacggaatagac
aaactgttctcatcaaagggcttgtgccttacttgcaccgtacctcagaggcacggcttt
gttagagtaaggctactaacacctcccggcttgcaaaaagcgaatggttaccaattacga
ataacaaacaaagatctaaaagtaccgggagacgacacgacgtactggtgcaaagtcgtt
aggctgcccgaattcgtcacgtcaaaagttcatcatatagttcagttcgaatcgacaata
actcccggtaacgaaggcctagttcatcacatggaagtcttctattgcgacgaagatccc
cacaaggaaatgccggcatacgagggaaattgttttgccgcagagagaccggctattacg
aaaagttgttctaaggtaaaagcggcatgggcaatgggcgctcccccttttacctaccca
aaagaagcgggcctcccactcggtggcccgaaagccaacaaatacgtcatgctagaagtc
cactacaacaatccagaattaaggaaagattgggtcgacagttcgggtattgttctctat
ataactggaaggaagcgtacgtacgatgccgccattatggaattgggcttagaatacacc
gacaaaatggctatacctggtgaacaaaaagcatttccgttaactggttactgtatccct
cagtgtactggagtgggcctaccggatgaaggcattacagtttttggaagtcaacttcac
acgcatttaactggtgccgcggtgtggaccagacactcgagacagggtgtagagcttccc
gtattaaacaaagacatgcattattctacgcattttcaggaaattagaatactgcatcgg
cccgttaaagtgctaccaggcgacttcttggaaaccacctgcatttacaatacggaagat
aagttaaacgcgacgatcggcggccacgctataacggacgaaatgtgcgttaattacata
cattactatccggcgaccgaactcgaggtttgcaagagcgccgtgtcgaacgaagcactc
gagaaatatttcgatttcgaaaaacgatgggacgatataccgatttcgtcgaaggcgacg
ccacgtgataattatttagcgatccaaccgtggactagattaagagccgacacactacat
acgctgtacgtcgagtccccaatatcaatgcaatgcaacaaatccgatgggagtcgtttt
caaggtgattgggaaggaattccgataccgaaaataaaactgccgctttccgaagaaatt
cgaatctgtcctaaaattaactatttagtcgagacctaa

DBGET integrated database retrieval system