KEGG   Bombyx mori (domestic silkworm): 100862817Help
Entry
100862817         CDS       T02817                                 

Gene name
UGT42A1
Definition
UDP-glycosyltransferase UGT42A1
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
bmor  Bombyx mori (domestic silkworm)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmor00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100862817 (UGT42A1)
   00053 Ascorbate and aldarate metabolism
    100862817 (UGT42A1)
   00500 Starch and sucrose metabolism
    100862817 (UGT42A1)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100862817 (UGT42A1)
   00860 Porphyrin and chlorophyll metabolism
    100862817 (UGT42A1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100862817 (UGT42A1)
   00982 Drug metabolism - cytochrome P450
    100862817 (UGT42A1)
   00983 Drug metabolism - other enzymes
    100862817 (UGT42A1)
Enzymes [BR:bmor01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     100862817 (UGT42A1)
Glycosyltransferases [BR:bmor01003]
 Others
  Hydrophobic molecule
   100862817 (UGT42A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 512 aa AA seqDB search
MAKQTKIKLLLLTFIMSGVHTLNILGVFPYQGRSHFFVFQPYLEELARRGHSVTVISHFP
QTKALKNYRDISLANTTKIMENAFSVERSYKSLIEVSFYLMNTGVENCKIMLANKEVQDL
WKNKIHFDVAVVEQFNSDCALGLAYKLGIPVVGTNSHVLMPYQYERFGIHYNPSYMTFQF
LEGGTKPTLFQRIERTIFHHYYNFIFEYLSQRTNQNTLAQYFDDIPPLNELAREIKIMLF
YHNFVLSGPNILPSNVKEVGGYHVAQPKELRPDVKKFIEESEHGIIYISFGSMLKAAATS
LDKIEAILGAVAELPQRVIWKWEEGTLPGNPKNIFISNWLPQNDILAHPKVLAFYSHCGQ
LGTTEAIYHGVPVVGMPVFGDQPANAAAVEESGLGVQIQIEDLTKENLLGKLRTVLNPEF
RKRVKFISKAWNDRPVKAMDSAIFWTEFAAKYSNITFRSRSVDVPLYQYLVLDVIAVLGS
ISVISVFVVFKLLGRLCTSKRENDKKNKLKRK
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaacaaacgaaaataaaattgttgttgctcacgttcattatgagtggtgtgcat
acgttaaatatcctcggagtgtttccgtatcaaggcagaagtcatttttttgtgttccag
ccgtacctagaagaattggccagaagaggacacagcgtgactgtaatctctcatttccct
caaaccaaagcgcttaagaattatcgtgatataagcttagcaaacaccacaaaaataatg
gaaaacgccttttctgtcgaaaggtcctataaatctttgattgaagtcagcttttatttg
atgaacactggcgtggaaaattgcaaaataatgcttgccaataaggaggtacaggacttg
tggaaaaataaaatacattttgacgttgctgttgtcgaacagtttaacagtgattgtgca
ttagggctcgcttataaattaggaataccagtggtcggcacgaactcccacgttcttatg
ccttaccaatacgaaagattcggcatacattacaatccctcgtatatgacattccaattc
ttggaaggcggaacgaaacctacactgttccaacgtattgaaagaacaatattccatcac
tactataattttattttcgaatacctctctcaaagaaccaatcaaaatacactggcgcaa
tacttcgatgacattccacctttaaacgaattagctcgtgaaatcaaaataatgcttttc
tatcataactttgtgctatccggtcctaatattttaccttcaaatgtaaaagaagtcggg
ggctaccacgttgctcaacccaaggaactccgtccggatgtcaaaaagtttatcgaggaa
tctgagcacggcattatttatattagttttggatcgatgctaaaagctgcggctacttca
ttagataaaatcgaggctatattgggtgctgtcgctgaattacctcagagagtgatatgg
aaatgggaggaaggaacactacccggcaaccctaagaatattttcatatcaaactggctt
cctcaaaacgatattttagcccatccgaaagtactagctttctattcgcattgcggtcag
ctagggaccacggaggctatctatcatggagttcctgttgtgggaatgccggtcttcggg
gaccagcctgcaaatgcggcggccgttgaagagagtggtttaggtgtccaaatacaaatc
gaagatttgactaaagagaacctcttagggaaattaagaaccgttttgaatccagagttt
agaaaaagggtgaaatttatatcgaaagcgtggaacgaccgtcccgtaaaagcaatggat
agtgcaattttctggacagagttcgcagccaaatatagtaatattacgtttcggagtaga
tctgtcgatgtaccattgtaccaatacttggttcttgacgttattgctgtactcggcagc
ataagcgtcattagcgtattcgttgtattcaaattattaggtcggttatgtaccagtaag
agggaaaacgataaaaaaaataaactgaaaagaaagtaa

DBGET integrated database retrieval system