KEGG   Bombyx mori (domestic silkworm): 100862823Help
Entry
100862823         CDS       T02817                                 

Gene name
UGT47A1
Definition
UDP-glycosyltransferase UGT47A1
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
bmor  Bombyx mori (domestic silkworm)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmor00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100862823 (UGT47A1)
   00053 Ascorbate and aldarate metabolism
    100862823 (UGT47A1)
   00500 Starch and sucrose metabolism
    100862823 (UGT47A1)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100862823 (UGT47A1)
   00860 Porphyrin and chlorophyll metabolism
    100862823 (UGT47A1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100862823 (UGT47A1)
   00982 Drug metabolism - cytochrome P450
    100862823 (UGT47A1)
   00983 Drug metabolism - other enzymes
    100862823 (UGT47A1)
Enzymes [BR:bmor01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     100862823 (UGT47A1)
Glycosyltransferases [BR:bmor01003]
 Others
  Hydrophobic molecule
   100862823 (UGT47A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 536 aa AA seqDB search
MRVAWLLWLATVARAARLLVVLPTNTKSHYAMYSRLIEALAKRDHQLTVITHFPVDAPQP
NINQISLAGTIPEITNNLTRKYDSLKPNFIRNLEQIISECVNACETVVQQDSFKELLNST
ASFDLIIVEVFGSDCFLPLGHRFRAPVVGLLSSVPLPWVNDYLGNPETASYIPSYMMGYG
QHMSLWERLSNTIAIILAKILYTYKSRIPSQVIVDRVFGHGNNLQKLAKNYSVILSNSHF
SINEVRPLVPGLVEVGGLHLDHSQTLPKNMKKLLDASTDGVIYWSFGSMSRIETIPSEKL
SGIFEAISELPQLVFVKMDRRRLTKNITVPDNVYTMDWIPQYATLCHPNVKLFISHGGLL
GTQEAVACGVPMLMVPLYADQALNSQSMFDKNVARILDLHEADKYEWKRALHDLLSNKKY
RENSKTLKEIFLDRPINPLDMGVYWIEYVLRYRGAPHMRSPALDLSLSQYLLFDVIIINI
TITIVSVFILHALFKYLCTKCIKWCPKEKIVIEKRLFKNNVTLFVCLLRKCKVKIN
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtggcgtggctgctgtggttagcgacggtcgcacgcgctgctcgtctgctcgtg
gtgctgcccacaaacactaagagccattacgccatgtatagcaggcttattgaggcgcta
gcgaaaagggaccatcaacttaccgttatcacacacttccctgtggacgcaccgcaacct
aacattaatcaaataagcttagctggaacaataccggagatcactaataatcttacaaga
aaatatgattctttgaagccgaacttcatccgcaatttggaacaaatcatcagtgaatgc
gttaatgcttgcgaaacagtagtacagcaagattccttcaaagagttacttaattcgacc
gcttcttttgatttaattatcgtagaagtcttcggaagtgattgttttttacctttaggt
catagattccgggcccccgttgtcggattattgtctagcgtcccgctaccttgggtcaat
gattaccttggcaacccagaaacagcgtcttacataccgtcctacatgatgggttatgga
caacacatgagcctatgggaacgattatcaaacacaatagctattatattagctaagatt
ttatacacatacaaatcaaggattccttcacaagtgatagtagacagagtcttcggacat
ggaaataacttacaaaagctcgcgaaaaactacagtgtgattttatctaacagtcacttt
agcattaacgaagtccgacctcttgtgcctggtctagtagaagtaggcggtctacatttg
gatcacagtcaaacacttcctaagaatatgaagaaacttttagatgcgtcaacagacggt
gtcatctactggagctttggctcgatgtccagaatagaaacgatacctagcgaaaagctt
tcaggtatatttgaagcaatatctgaactaccacaattggtcttcgtgaagatggataga
agaaggctcacaaagaatatcactgtgcctgacaatgtatatactatggattggattccg
cagtatgctacattatgtcacccaaacgtcaagttattcatttctcatggaggcttgctt
ggcacacaggaagcagtggcttgtggggtacctatgttaatggtgcctctatatgctgac
caagctcttaattctcagtctatgtttgataaaaacgttgccagaattctggatctacac
gaggctgataaatatgaatggaagagagctttacatgatttattgagtaacaaaaagtat
agagaaaattcaaaaacgctaaaagaaatatttttagatagaccaataaatcctttagat
atgggcgtctactggattgaatatgtgctgagataccgaggtgcgccacatatgagatca
ccagccctagacctttccttatcacagtacttactgtttgatgtgataataattaatata
actattacaattgtgtctgtattcattttacatgctttgtttaaatatttgtgtacaaaa
tgcatcaaatggtgtcctaaagaaaaaattgtaattgaaaaaagactctttaaaaataat
gtaacattatttgtatgtcttctgaggaagtgtaaagtaaagattaattga

DBGET integrated database retrieval system