KEGG   Bombyx mori (domestic silkworm): 100862841Help
Entry
100862841         CDS       T02817                                 

Gene name
UGT33D7
Definition
UDP-glycosyltransferase UGT33D7
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
bmor  Bombyx mori (domestic silkworm)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmor00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100862841 (UGT33D7)
   00053 Ascorbate and aldarate metabolism
    100862841 (UGT33D7)
   00500 Starch and sucrose metabolism
    100862841 (UGT33D7)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100862841 (UGT33D7)
   00860 Porphyrin and chlorophyll metabolism
    100862841 (UGT33D7)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100862841 (UGT33D7)
   00982 Drug metabolism - cytochrome P450
    100862841 (UGT33D7)
   00983 Drug metabolism - other enzymes
    100862841 (UGT33D7)
Enzymes [BR:bmor01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     100862841 (UGT33D7)
Glycosyltransferases [BR:bmor01003]
 Others
  Hydrophobic molecule
   100862841 (UGT33D7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 515 aa AA seqDB search
MKFYILLALILTDGKEAARILGVFPVPSISHQVAFRPLTLELAKRGHELVVLTPNPVFAK
GKSPENYTEIDVHDISYQIWTKGFLETSRGKRQDIFEQSRVAMDVLYDIFSQQLLTDEFQ
AILKSEKKFDLLILEAMMRPARILCHVFNAPAVIISSFGGIGDIYDTVGAATHPLLYPIV
TRQKLYNLSFWEKLSEMHNHYTFERMWKEYDKKENELVKSVFGSNVPSLSEMVDRISLIL
LNVHSIWEQNRPVPPNLIYVGGIHQKPQQELPSDLKTYLDSSKHGVIYISFGTNVVPSLL
PPERIQILIKVFSQLPYDVLWKWDKDELPGKSKNIRISKWLPQSDLLRHPKIKVFITQGG
LQSTEEAITGGVPLIGMPMLGDQWYNVEMYLIHTIGLRLELDELSEGRLRNNIEEIIDNE
SYRQNIARLRSQMYDQPQSSLERAVWWTEHVLRHGGAQHLRAAGANLSWSQYLELELVSV
LLISFLITLTILSYIILYLWRLLRTYKDIVKIKRS
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgaagttttatatattacttgctttaattttaactgacgggaaagaagcggcacggatt
ttgggcgtttttccggtgccctcaatcagccaccaagtggctttccgacctttaacatta
gagctagcaaaacgaggccacgagctagtcgtcctcacgccaaaccctgtcttcgctaaa
gggaaatctccagaaaactacacagaaatagatgtccatgacatatcttaccaaatttgg
acaaaaggcttccttgaaacatcaagaggaaaacgtcaagatatcttcgaacaatctaga
gtagcaatggatgtactgtatgatattttttcccaacaattattgaccgatgagttccaa
gctatactaaaaagcgaaaaaaagttcgatttgctaattttagaagccatgatgagaccg
gccaggattctttgtcacgtgttcaatgcacccgctgtcatcataagttctttcggcggc
attggagatatttatgacacagttggagccgcaacccatccattgctgtatccaattgtg
acgcggcaaaaactttacaatctatcgttttgggaaaagttaagtgaaatgcacaatcat
tatacctttgaacgcatgtggaaagagtacgacaagaaagagaatgagctggttaagagc
gtctttggctccaatgtcccaagtttaagcgaaatggtggatagaatcagcttgatacta
ttgaacgtacattcgatttgggaacagaatcgtccggttccaccgaatcttatttacgtt
ggaggaatccatcagaagccacaacaggaattgccttcggatcttaaaacctatttagat
tcatccaaacacggggtaatttacatcagttttgggacgaacgtggtaccttcactgttg
ccaccagaacgaatccaaatcctgattaaagtgttctcccaactgccctacgatgtgctg
tggaagtgggataaagatgagctgccgggaaagtcgaaaaacatcagaatttcaaagtgg
ctgccacaatctgatctgctaaggcatccaaagatcaaagttttcattacccaaggtggt
ctgcagtcaacagaagaagcgatcactggcggagtacccctaattgggatgccgatgttg
ggcgaccagtggtacaacgtggagatgtacttgattcatacaatcggattaagacttgag
ctggatgagctttctgaagggagactccggaataatattgaagagatcatcgataatgaa
agctatcgtcagaacatagctcgtctccggagccagatgtacgaccagcctcagagctca
ttggagcgcgccgtgtggtggacggagcacgtgctgcgtcacggaggagcccagcatctc
cgagctgccggcgccaatctctcctggtcacaatacttggaattggaattagtttcagta
ttactcattagttttcttataacactaacgattttgagttacattatattgtatttatgg
aggcttctacgtacttacaaagatatagttaaaattaaaagatcttaa

DBGET integrated database retrieval system