KEGG   Bombyx mori (domestic silkworm): 101735516Help
Entry
101735516         CDS       T02817                                 

Definition
polyprenol reductase-like
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
bmor  Bombyx mori (domestic silkworm)
Brite
Enzymes [BR:bmor01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     101735516
    1.3.1.94  polyprenol reductase
     101735516
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 305 aa AA seqDB search
MPNILDFVFLNLAISVTFTGVLIKKFEDYVPAFIKKSFSYGSFAYQGSEANFLKIIEIPK
AYYRHFYLFSSIFSVLSLFYMILVYFLGFSVNEYLFTVLNYILLEDQTPVSVTAALLALS
LLTLQCLRRLYETYYLQVFAKSSKMNISHYFAGIIHYFACIVVCVGQAPLFCGSQNREKV
TWIDTKTTILFVPCTLIFLWCWYEQYQTNIIFAYLRKDKKSNKIVTEDHRVPNGRMFKYV
SSPHRMCEIIMYTVLVFLITTKTFVCIYLWVLSNQIQTGIHAHEWYKKTFKNYPAKRTAV
FPYVL
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgcccaacattttagacttcgtgttcctcaatctcgctatctcggtgacttttaccggt
gttttaataaaaaaattcgaagattacgttcctgctttcataaaaaaaagtttctcctat
ggttccttcgcttatcaaggatcggaagcgaactttttaaaaataattgaaatacctaaa
gcttactacagacatttttatttattttcgtcaattttcagtgttttatcattattttat
atgatattagtttattttctcggctttagtgtaaacgaatatctctttaccgtattgaat
tacattctactcgaagatcaaacccctgtatcagtcacagcagctcttttggcactctct
cttctcaccttgcaatgcctacggagactatatgagacgtattatttacaagtatttgca
aagtccagcaaaatgaacattagccactatttcgctggaatcatacactattttgcatgt
atagttgtgtgtgttggacaagcaccactgttttgtggaagtcaaaatagagaaaaagtg
acatggattgatacaaaaactacaattttatttgtaccctgtaccttaatcttcctttgg
tgttggtatgaacagtatcaaacaaacatcatattcgcatatctcagaaaagacaaaaaa
tcaaataaaattgttacagaagatcaccgtgtacctaatgggagaatgtttaaatatgtt
tcgagtccccatagaatgtgtgagataataatgtacactgttttagtatttttaataaca
acaaagacttttgtgtgcatttatttatgggttttgtctaatcagatacaaacaggcatc
catgcccatgaatggtataagaaaacattcaagaactatccagcgaagagaactgcagtc
ttcccttatgtactgtaa

DBGET integrated database retrieval system