KEGG   Bombyx mori (domestic silkworm): 101735688Help
Entry
101735688         CDS       T02817                                 

Definition
(RefSeq) uncharacterized LOC101735688
  KO
K11306  
histone acetyltransferase MYST4 [EC:2.3.1.48]
Organism
bmor  Bombyx mori (domestic silkworm)
Brite
Enzymes [BR:bmor01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101735688
Chromosome [BR:bmor03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    101735688
   HAT complexes
    MOZ/MORF complex
     101735688
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 826 aa AA seqDB search
MCDPDEVGKEVWKRWILEAIHKIRSQKQRPSVERICHAIRQHHNYHEDIVSERLERAVRE
GVVLKVYNKGQSSYKDPGGMQNRTLRLAPNVDISRPVAKIVRELGERDGSTLKSIERHLY
QAYQIIVSPDVDVKAILRAAVKRAVARGLLSHHAGAYVVADSSNNTSSDRSSKQKKHSQD
SSEEKQVQGGVPVCSECLGTDTKNQSGIAESLICCSQCKSYAHPSCLDLLDHVTQTTVKT
SRWSCGECATCLVCGAGGAWAARCAVRCGRHAHPRCAAPPWRCPTCTLPRRVPSRTRALQ
PRVPRPLIGSRCRRTPAADAAAARPRKPKTPRRPRSDEERSDECSRLPVKHSNEPSNKNE
STSQASEQNRDAYGQPACDRRPEHPKVDAYADVERIKNKLTSPAGGAKDAELPFRDDASH
ARKDEITVTRTGSESTPPVYHAPVVTNSMTIQEINAAQHTFLNHRANVSKESQGVQTDRV
LKSNEANRGASKGTKLEVPHPITSPVVNSDAAQFLPRCHSANAAVGLGAEPDLKPREKSK
LRDVRVNSAHCKLEKGDKRPARADTPLRKPDPAPDAHKKNVAIKHDRAEQAEPRAASKIN
RGGGEASKAGARAAHTPPAPPRARATPPATHAAMQPAASAAYQGGYLSFQQQQQYHAAGW
PPSCSLAKLQQMADAPQHHPHAHPHPHQYAQQAGTPPGSVGGVGGVGGVAGVGGVGGVGA
QYHAKYYAPHHNQLDSPRNARTAPSNLSPMQHMQMGAGSRVSPHLISQYGLNGYRVPPGA
AAAAQQQFNNLPGAVSQQAVSQQHNVYYSPYINPPPPLAALNSARR
NT seq 2481 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgatccagacgaagttgggaaagaagtgtggaagcgatggatcttggaagcgatt
cacaagattcgttcgcagaaacagaggccgagcgtggagagaatctgtcatgccatcaga
cagcatcacaactatcacgaagatatagtgtccgagcggctagaacgcgccgttcgagaa
ggtgtagtgctcaaagtgtacaacaagggccaaagctcatacaaagaccctgggggcatg
cagaacagaactttgcgcttggcgccaaacgtggacatctctcggcccgtagccaagata
gtgcgcgaattaggagaaagagacggttctactttgaaatcgatagaaagacatttatat
caagcgtatcaaataatagtgtcacccgatgtggacgtgaaagcgatacttcgtgcggca
gtgaaacgcgctgtagcccgcgggctactgtcgcatcacgcgggtgcgtatgtggtagct
gacagctctaacaacacatcttctgatagatcatccaaacagaaaaaacattctcaagat
tcatctgaagagaaacaagttcaaggcggagtaccggtttgtagcgagtgtctgggaact
gatactaagaatcaatctggaattgctgaatcactcatatgctgttcacagtgcaagtcc
tatgcacatccttcatgtctagatcttttagatcacgtaactcaaactactgtgaagacc
tcacgatggtcatgtggggaatgtgcaacgtgcctggtatgcggggcggggggcgcgtgg
gcggcgcgctgtgctgtccgctgcggccgccacgcacacccgcgctgtgccgccccgccc
tggcgctgccccacctgcacgctgcccaggcgagtgcccagccggacccgtgccctccag
cctcgcgtcccacgcccgctaatcggatctcgctgtcgcaggacccccgctgccgacgcc
gcagccgcgaggcctcggaaacctaagacgccgcgccggccccgctctgacgaggaacgc
tccgacgaatgcagtcggctgccggtgaaacattcaaatgaaccttcgaacaagaatgaa
agcacaagtcaagcatctgaacaaaatcgagacgcttacggccagcccgcctgcgaccgg
agaccagaacatcctaaggtcgacgcgtacgccgacgtagagcgcatcaagaacaagttg
acgagtccggcgggaggcgcgaaggacgcggagctaccgttccgggacgacgcgtcgcac
gccaggaaggacgaaataacagtgacgcgaaccggctcggagtctactccgcccgtctac
cacgcgcccgtcgtcaccaactccatgaccatccaggagatcaacgccgcccagcacacg
ttcctcaaccaccgcgccaacgtcagcaaagagtcccaaggagtgcagacagaccgcgtc
ctgaaatccaacgaagccaaccgcggcgcctccaaaggcaccaaactggaggtgccgcac
cccatcacctcgcccgtcgtcaacagcgacgccgcgcagttcctgccgcggtgccacagc
gccaacgcagccgtcgggctgggggcggagcccgacctcaagccgcgcgagaagagcaag
ctgcgcgacgtgcgcgtcaactcggcgcactgcaagctcgagaagggcgacaagcggccg
gcgcgcgccgacacgccgctgcgcaagcccgacccggcgcccgacgcgcacaagaaaaac
gtcgcgatcaagcacgaccgcgccgagcaggccgagccgcgggccgcatccaagataaac
cgcggcggaggcgaggcgagcaaggcaggagcccgcgccgcgcacacgccacccgcgccc
ccccgcgcccgcgccaccccgcccgccacgcacgccgccatgcagcccgccgcctccgcc
gcctaccagggcggctacctgtccttccagcagcagcagcagtaccacgccgcgggttgg
ccgccctcctgctcgctcgccaagctgcagcagatggcggacgcgccccagcaccatccg
cacgcgcatccgcacccccaccagtacgcacagcaggcgggcacgccgccgggctcggtg
ggcggcgtgggcggcgtgggcggagtggcaggcgtgggcggagtgggcggtgtaggcgcg
cagtaccacgctaagtactacgcgccgcaccacaaccagctcgactcgccgcggaatgct
cgtaccgcgccaagtaacctgagccccatgcagcacatgcagatgggcgccgggtcccgc
gtgtcgccgcacctcatcagccagtacgggctgaacgggtaccgcgtgccgccgggcgcc
gccgccgccgcccagcagcagttcaacaacctgccgggcgccgtgtcgcagcaggccgtc
tcgcagcagcacaacgtgtactactcgccttacatcaacccgccgccgccgctggccgcg
ctcaactcggcgcgtcggtag

DBGET integrated database retrieval system